(data stored in ACNUC7421 zone)

EMBL: AP011115.GVPK

AP011115.GVPK        Location/Qualifiers
FT   CDS_pept        349560..349892
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gvpK"
FT                   /locus_tag="ROP_03370"
FT                   /product="putative gas vesicle synthesis protein GvpK"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_03370"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48584"
FT                   /db_xref="GOA:C1ARA7"
FT                   /db_xref="InterPro:IPR007805"
FT                   /db_xref="UniProtKB/TrEMBL:C1ARA7"
FT                   /protein_id="BAH48584.1"
FT                   /translation="MAESEPADSDAPSEIGRRVLPQRIDADPESVEKGLVTLVLTIVEL
FT                   LRQLMERQALRRVEHGDLTDDQIERIGTTLMLLEERMAELRDHFDLTPEDLNIDLGPLG
FT                   PLLSNE"
     atggctgagt ccgagcccgc cgattcggac gccccgagcg agatcggccg ccgggttctt        60
     ccacagcgga tcgacgcgga ccccgaatcc gtcgagaagg gcctggtcac cctcgtactg       120
     acgatcgtcg agctactgcg gcagctgatg gaacggcagg cgctgcgccg agtcgagcac       180
     ggcgacctca ccgacgacca gatcgaacgc atcggcacga cgctcatgct gctcgaggaa       240
     cgcatggcag agttgcgtga tcatttcgat ctcacacccg aggacctgaa catcgacctc       300
     ggaccgctcg gtccgctgct gtcgaacgaa tag                                    333
//

If you have problems or comments...

PBIL Back to PBIL home page