(data stored in ACNUC7421 zone)

EMBL: AP011115.GVPL

AP011115.GVPL        Location/Qualifiers
FT   CDS_pept        348575..349354
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gvpL"
FT                   /locus_tag="ROP_03350"
FT                   /product="putative gas vesicle synthesis protein GvpL"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_03350"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48582"
FT                   /db_xref="GOA:C1ARA5"
FT                   /db_xref="InterPro:IPR009430"
FT                   /db_xref="UniProtKB/TrEMBL:C1ARA5"
FT                   /protein_id="BAH48582.1"
FT                   /translation="MTADDGVWLYSITTDSVDDAQLAEVTGVAGEPVRAVASAGLVAVV
FT                   GTVSLSEFGQEPLQRKLEDLDWLAATARAHDAVVAAVTRRGPTVPLRLATLYLDDDRVR
FT                   VLLTERREEFGATLRRVTGRSEWGVKGYGDAKILSQDVKEEPSPTGAAGKGTAYLLRRR
FT                   AELSAQQDVERKAADHAGEIHAALLEQAVDGLRRQVTDPVLTGKRAWMIFNGTYLVDND
FT                   RIEGFAALVTALDTERPGITLELTGPWPPYSFAGIDG"
     atgaccgcag atgacggggt ctggctctac agcatcacca ccgacagcgt cgacgacgcg        60
     caactcgccg aggtcaccgg tgtggcgggc gagccggtgc gggctgtggc gtcggcgggt       120
     ctcgtcgctg tggtggggac ggtgagtctc agcgaattcg ggcaggaacc cctgcaacgc       180
     aaactcgagg acctcgactg gctggccgca accgcgagag cacacgacgc cgtggtggcg       240
     gccgtaacgc gccgtggacc caccgttccg ttgcggttgg cgaccctcta cctcgacgac       300
     gaccgcgtcc gcgtcctcct cacggaacga cgggaggagt tcggtgcgac gctgcgccgg       360
     gtgaccggtc gcagcgaatg gggcgtcaag ggatacggag acgcgaagat cctgtcgcag       420
     gatgtgaagg aggagccgtc cccgaccggt gcggcaggga agggaaccgc gtatctcctg       480
     cgccgccgcg cggagttgag cgcgcagcag gacgtcgaac gcaaggccgc agaccatgcg       540
     ggagaaattc acgctgcgct cctggagcag gccgtcgacg ggttgcgccg gcaagtcacc       600
     gatccggtgc tgaccggcaa acgggcgtgg atgatcttca acggcaccta cctcgtcgac       660
     aacgatcgga tcgagggttt cgctgcactc gtcactgcac tcgacaccga acgtccgggc       720
     atcacattgg aattgaccgg accgtggccg ccgtattcgt tcgccgggat cgacgggtga       780
//

If you have problems or comments...

PBIL Back to PBIL home page