(data stored in ACNUC7421 zone)

EMBL: AP011115.GVPO

AP011115.GVPO        Location/Qualifiers
FT   CDS_pept        347894..348184
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gvpO"
FT                   /locus_tag="ROP_03330"
FT                   /product="putative gas vesicle synthesis protein GvpO"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_03330"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48580"
FT                   /db_xref="GOA:C1ARA3"
FT                   /db_xref="InterPro:IPR008634"
FT                   /db_xref="UniProtKB/TrEMBL:C1ARA3"
FT                   /protein_id="BAH48580.1"
FT                   /translation="MAEEEPPPLPAPEIAEIATRDVAKLTGKKPLGATSVMPTDDGWTV
FT                   EVEVVEDRRIPSSTDMLALYEVVLDLDGELLSYRRTRRYIRGVGDSGSAQS"
     atggcagaag aggagccacc tccgttgcct gcaccggaga tcgccgagat cgcgacgcgt        60
     gacgtcgcga agttgaccgg caagaaaccc ctcggtgcca catcggtcat gcccaccgac       120
     gacggctgga cggtggaagt ggaggtggtc gaggatcgtc ggatcccgtc gtcgacggac       180
     atgctcgcgt tgtacgaggt ggtgttggat ctggatggag aactgttgtc ctatcgcaga       240
     acccgccgtt acatccgcgg tgtcggtgac agtgggagtg cgcagtcatg a                291
//

If you have problems or comments...

PBIL Back to PBIL home page