(data stored in ACNUC7421 zone)

EMBL: AP011115.HISF

AP011115.HISF        Location/Qualifiers
FT   CDS_pept        complement(784319..785092)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hisF"
FT                   /locus_tag="ROP_07480"
FT                   /product="imidazole glycerol phosphate synthase subunit
FT                   HisF"
FT                   /EC_number="4.1.3.-"
FT                   /note="protein synonym:IGP synthase cyclase subunit"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_07480"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48995"
FT                   /db_xref="GOA:C1ATY7"
FT                   /db_xref="InterPro:IPR004651"
FT                   /db_xref="InterPro:IPR006062"
FT                   /db_xref="InterPro:IPR011060"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/Swiss-Prot:C1ATY7"
FT                   /protein_id="BAH48995.1"
FT                   /translation="MTLAVRVIPCLDVDAGRVVKGVNFENLRDAGDPVELAAAYDAQGA
FT                   DELTFLDVTASTADRGTMLDVVSRTAEQVFIPLTVGGGVRTVEDVDRLLRAGADKVSVN
FT                   TAAIARPELLRELSERFGSQCIVLSVDARTVPQGQPDTPSGWEVTTHGGKRGTGIDAVE
FT                   WAVRGAELGVGEILLNSMDADGTKAGFDLPMIRAVRAAVHVPVIASGGAGAVEHFAPAV
FT                   GAGADAVLAASVFHFGDMTIGDVKKSMRAEGITVR"
     atgactctgg cggttcgagt gatcccgtgt ctggacgtcg atgccggacg cgtcgtcaag        60
     ggcgtcaact tcgagaacct gcgggatgcg ggcgaccccg tcgaactggc ggcggcgtac       120
     gacgcgcagg gcgccgacga gctcacgttc ctcgacgtca ccgcgtccac cgcggaccgg       180
     ggcaccatgc tcgacgtggt gagccggacg gcggagcagg tgttcattcc gctcacggtc       240
     ggcggcggtg tccgcaccgt cgaggacgtc gaccggttgc tgcgtgccgg cgccgacaag       300
     gtgagcgtca acaccgccgc gatcgcgcgg cccgagttgc tccgcgaact cagcgaacgc       360
     ttcggctccc agtgcatcgt gctgtccgtg gacgcacgca ccgtgccgca ggggcagccg       420
     gacaccccgt cggggtggga ggtcacgacc cacggcggca agcgcggcac cggcatcgac       480
     gcggtcgagt gggcggtccg cggcgccgaa ctgggcgtcg gggagatcct gctcaactcg       540
     atggacgcgg acggcacgaa ggccggtttc gacttgccga tgatccgcgc ggtccgcgcc       600
     gccgtgcacg tgccggtgat cgccagcggg ggagcgggcg ccgtcgagca cttcgcgccc       660
     gccgtcgggg ccggcgcgga cgccgttctc gccgccagcg tcttccactt cggcgacatg       720
     accatcggcg acgtcaagaa gtccatgcgc gcagagggga tcaccgtccg atga             774
//

If you have problems or comments...

PBIL Back to PBIL home page