(data stored in ACNUC7421 zone)

EMBL: AP011115.HMUT

AP011115.HMUT        Location/Qualifiers
FT   CDS_pept        643122..644162
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hmuT"
FT                   /locus_tag="ROP_06200"
FT                   /product="putative hemin ABC transporter hemin-binding
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_06200"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48867"
FT                   /db_xref="InterPro:IPR002491"
FT                   /db_xref="UniProtKB/TrEMBL:C1AST5"
FT                   /protein_id="BAH48867.1"
FT                   /translation="MKSMFRAFTNRSLFAVLVLLLVSVVAVSACSSGAGDNAGGTGGAR
FT                   TAVLDDLNPEPLASAATPALPVTVRSFDGVDVTITDASRIVTADRYGTLTETVFALGLG
FT                   DNVVGRDIASEFPAAQHVPVVTPGGQSLNAEAILDLAPTVILTDTSIGPQAVQDQLRAA
FT                   GVPVVYFDPTRTLDGVPGQITAVANALGVPEQGRELADRTENEIAAARSRAPEGENPLK
FT                   IAFLYLRGTAITMIGGPGSGADSLIDALGAVDAGTASGITQQFAPITSEALIAAAPDVL
FT                   LLMTGGLESIGGIEGLEKIPGVAQTPAGRNQRVVDMQDGVLLSFGPNTGRVLGALADAV
FT                   YPAATR"
     atgaagtcga tgttccgggc cttcacgaac aggtcgctct tcgccgtcct cgtcctgctc        60
     ctggtgtctg tggtggcggt ctcggcgtgc agttccggtg ccggcgacaa tgcgggcggc       120
     accggcggcg cgcgcacggc ggttctcgac gacctgaatc ctgagcctct cgcgtccgcg       180
     gcgacaccgg cgttgcccgt cacggtccgc agtttcgacg gggtggacgt gaccatcacg       240
     gacgcgagcc ggatcgtgac cgcggatcgc tacggaacgc tcaccgagac ggtgttcgcg       300
     ctggggctcg gcgacaacgt ggtgggccgg gacatcgcgt ccgagttccc ggccgcgcag       360
     cacgtgccgg tggtcacacc cggcgggcag tccctcaacg ccgaggccat cctcgacctg       420
     gcgccgacgg tgatcctcac cgacacgagc atcgggccgc aggcggtgca ggatcagctc       480
     cgggcggccg gcgtgccggt cgtctacttc gatccgacgc gcaccctcga cggcgtgccc       540
     ggccagatca ccgcggtggc gaatgcgctc ggtgtgccgg agcagggccg ggaactcgcg       600
     gaccgcacgg agaacgagat cgcggcggcc cgcagtcgcg cccctgaagg cgagaatccg       660
     ctgaagatcg cgtttctcta tctgcgcggc accgcgatca ccatgatcgg cggcccgggt       720
     tcgggggccg actccctgat cgacgcgctc ggcgctgtcg acgccggcac cgcctcgggg       780
     atcacgcagc agttcgcgcc gatcaccagc gaggcgctga tcgccgccgc ccccgacgtg       840
     cttctcctga tgaccggggg gctcgagtcg atcggcggga tcgagggcct ggagaagatc       900
     cccggagtgg cgcagacacc ggcgggccgg aaccagcggg tcgtggatat gcaggacggg       960
     gtgcttctca gcttcggccc gaacaccggt cgcgtcctgg gcgccctggc cgacgccgtc      1020
     tacccggccg ccactcgatg a                                                1041
//

If you have problems or comments...

PBIL Back to PBIL home page