(data stored in ACNUC7421 zone)

EMBL: AP011115.HMUU

AP011115.HMUU        Location/Qualifiers
FT   CDS_pept        644159..645229
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hmuU"
FT                   /locus_tag="ROP_06210"
FT                   /product="putative hemin ABC transporter permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_06210"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48868"
FT                   /db_xref="GOA:C1AST6"
FT                   /db_xref="InterPro:IPR000522"
FT                   /db_xref="InterPro:IPR037294"
FT                   /db_xref="UniProtKB/TrEMBL:C1AST6"
FT                   /protein_id="BAH48868.1"
FT                   /translation="MTVEDLDAPGKSSPRTRTGAVLGGLLIALAVAAVFSACIGQVPTG
FT                   PGEVVGSILHRIGLDLGPMPAHPSGEVTLWEVRFPRVVLAILVGAALGCAGALLQGVFA
FT                   NPLAEPGVIGVSAGAAVGASAAIVVGAFAAGWTVAGAAFVAGLVTTVAVYLLARHEGRT
FT                   EVVTLVLTGVAVNAFAGGLIAFFTFVASPAARDQIVFWQLGSLNGATWSAVAVVAPMTV
FT                   AGIAATMMIAGKLDLLSLGENAARHLGLDVERLRQIAVLIVALLVSSSVAFTGIILFVG
FT                   LVVPHLMRIAVGPGHRALIPASALCGSLVLLLADLGARSLVANADLPLGMLTALVGGPF
FT                   FFWLLRRTRASQGGWA"
     atgaccgtcg aagacctcga cgctcccggt aagtcctcgc cacgcacccg gaccggtgcc        60
     gtcctcggcg gtctgctgat cgccctcgcc gtcgccgccg tgttctcggc ctgcatcggt       120
     caggtgccga ccggtcccgg ggaggtcgtc ggcagcatcc tgcaccgaat cggactggat       180
     ctcgggccga tgcccgcgca ccccagcggc gaagtgacgc tgtgggaggt ccggtttccg       240
     cgcgtggtcc tcgcgatcct ggtgggggcg gcactcggat gcgcgggagc gttgctgcag       300
     ggtgtgttcg ccaacccgct cgccgaaccc ggcgtcatcg gagtgtcggc aggtgccgcg       360
     gtcggagcca gcgcggcgat cgtcgtcggc gcgttcgcgg ccgggtggac ggtggccgga       420
     gccgccttcg tcgccggact ggtcacgacc gtcgccgtct atctcctggc ccggcacgag       480
     ggtcggacgg aggtcgtcac cctcgtcctg accggtgtcg cggtcaacgc gttcgccggc       540
     ggactcatcg ccttcttcac gttcgtcgcg tcccctgcgg cacgcgatca gatcgtgttc       600
     tggcaattgg gcagcctcaa cggggccact tggagcgcgg tagcggtagt ggcgccgatg       660
     acggtcgccg ggatcgccgc caccatgatg atcgccggga aactcgacct gctctcgctc       720
     ggcgagaacg cggcacgcca cctcggcctc gacgtcgaac ggctgcgtca gatcgcggtg       780
     ctgatcgtcg ccctgctcgt ctcgtccagc gtggccttca ccgggatcat tctcttcgtc       840
     ggactggtgg tcccgcacct gatgcgcatc gccgtcggac cgggccaccg agccctcatc       900
     ccggcgagcg cactgtgcgg atccctcgtg ctgctgctcg ccgacctggg cgcccgctcg       960
     ctcgtggcca acgcggacct cccgctcggc atgctcacgg ccctcgtcgg cgggcccttc      1020
     ttcttctggt tgctgcgccg cacccgggcc agtcagggcg ggtgggcatg a               1071
//

If you have problems or comments...

PBIL Back to PBIL home page