(data stored in ACNUC7421 zone)

EMBL: AP011115.HMUV

AP011115.HMUV        Location/Qualifiers
FT   CDS_pept        645226..646104
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hmuV"
FT                   /locus_tag="ROP_06220"
FT                   /product="putative hemin ABC transporter ATP-binding
FT                   protein"
FT                   /EC_number="3.6.3.34"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_06220"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48869"
FT                   /db_xref="GOA:C1AST7"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR015863"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C1AST7"
FT                   /protein_id="BAH48869.1"
FT                   /translation="MSPSFHPLRTRVGEALDQNLFRRTDPVPPPRPSGAVTLRAEGIAV
FT                   TRGGRPVLDDVSVDVRIGEVLVLVGPNGAGKSTLLAALSGDQDVHAGSVELDDRDLGEW
FT                   TALEMAQRRAVLPQQNTVGFSFTARQVITMGRSPWARTPRSDDDAAAIAEAVRICDVVA
FT                   FADRPFTALSGGERARVALARVLAQRTETILLDEPTAALDLGHQETVMRLARSRAEQGT
FT                   AVVVVLHDLALAAAYADRIVVLEQGRVAADGPPRDVLSEGLLTRVYGHPVEVIAHPVTG
FT                   ATLVLPRRDHR"
     atgagtccgt cgttccaccc gctccgcacc cgcgtcggcg aggccctcga tcagaacctg        60
     ttccggcgga ccgacccggt gcccccgccg cgaccctcgg gggccgtgac gctgcgggcg       120
     gagggtattg ccgtcacccg cggtggaaga cccgttctcg acgacgtgtc cgtggacgtg       180
     cggatcgggg aggttctcgt tctcgtcggc cccaacgggg cgggcaagtc gacactcctc       240
     gcggcgctgt cgggtgatca ggacgtgcac gcgggcagcg tcgaactcga cgaccgggac       300
     ctcggcgagt ggacggcgct cgagatggcc cagcgacgcg cggtcctccc ccagcagaac       360
     acggtcggat tctcgttcac cgcacgtcag gtgatcacga tgggccggtc cccgtgggcg       420
     cgcacacccc gcagcgacga cgacgccgcc gcgatcgccg aggccgtgcg gatctgtgac       480
     gtcgtggcgt tcgccgaccg gccgttcacc gcgctgtcgg gcggtgaacg cgcccgcgtg       540
     gcgctggccc gggtgctggc gcagcggacc gagacgatcc tgctggacga gcccaccgcc       600
     gccctcgatc tcggccatca ggagacggtg atgcgcctgg cccgctcccg cgcggaacag       660
     ggtactgcgg tggtggtcgt gctccacgac ctcgcgctcg ccgccgcgta cgcggaccgg       720
     atcgtggtcc tcgagcaggg ccgcgtcgca gccgacggac ctccccgcga cgtcctgtcc       780
     gagggcttgc tgacccgggt gtacgggcac ccggtcgagg tcatcgcgca tccggtgacc       840
     ggcgcgaccc tcgtcctccc ccgccgcgac caccgctag                              879
//

If you have problems or comments...

PBIL Back to PBIL home page