(data stored in ACNUC7421 zone)

EMBL: AP011115.MAP

AP011115.MAP         Location/Qualifiers
FT   CDS_pept        458994..459779
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="map"
FT                   /locus_tag="ROP_04500"
FT                   /product="methionine aminopeptidase"
FT                   /EC_number="3.4.11.18"
FT                   /note="protein synonym:peptidase M"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_04500"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48697"
FT                   /db_xref="GOA:C1ARM0"
FT                   /db_xref="InterPro:IPR000994"
FT                   /db_xref="InterPro:IPR001714"
FT                   /db_xref="InterPro:IPR002467"
FT                   /db_xref="InterPro:IPR036005"
FT                   /db_xref="UniProtKB/TrEMBL:C1ARM0"
FT                   /protein_id="BAH48697.1"
FT                   /translation="MEDERVLELKTPREIEAMRTTGAFIAELLDDLQSRAAVGVNLLDL
FT                   EHRARHLIKDRGAVSCYWDYAPSFGRGPFHNVICLSVNDAVLHGLPHDYTLRDGDLLSM
FT                   DIAVSIDGWVADSARSLIVGTPHAGDQRLIEATERALDAGIDAARPGRRLGDISAAIGA
FT                   VATDYGFPVNTEFGGHGLGRTMHEDPHVSNQGRAGRGLVLRPGLTLALEPWFARGTDKI
FT                   VYDPDGWTIRSADGSRTAHSEHTIAITDGDPLVLTRRSA"
     gtggaggatg aacgagtgtt ggaactgaag acgccacggg agatcgaggc aatgcgcacc        60
     accggcgcgt tcatcgcgga actactcgac gacctgcaat cgcgtgctgc agtaggagtg       120
     aatctgctcg acctcgaaca ccgcgcccga cacctgatca aggaccgcgg ggcggtgtcc       180
     tgctattggg actacgcgcc gtcgttcggc cgcggtccgt tccacaacgt catctgcctg       240
     tccgtcaacg atgctgtgct tcacggcctc ccacacgact acaccctgcg cgacggggac       300
     ctgctgagca tggacatcgc ggtatcgatc gacgggtggg tggccgactc ggcgcgcagc       360
     ctgatcgtcg gcacacccca cgccggcgac cagcggttga tcgaggccac cgaacgcgcg       420
     ctcgacgccg gtatcgatgc cgcacgcccg ggccggcgcc tcggcgacat ctccgccgcg       480
     atcggcgcgg tcgccaccga ctacggtttc cccgtcaata ccgaattcgg cgggcacggt       540
     ctcggtcgaa ccatgcacga ggacccgcac gtctccaacc aggggcgagc cggacggggc       600
     ctggtgctgc gaccgggcct gaccctcgca ctagagccct ggttcgcccg tggcaccgac       660
     aaaatcgtct acgaccccga cgggtggacc atccgatcgg ccgacggctc gcggaccgct       720
     cacagcgaac acacgatcgc gatcaccgac ggtgatcccc tcgttctgac acgccgctcc       780
     gcctga                                                                  786
//

If you have problems or comments...

PBIL Back to PBIL home page