(data stored in ACNUC7421 zone)

EMBL: AP011115.METH

AP011115.METH        Location/Qualifiers
FT   CDS_pept        complement(613327..616896)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="metH"
FT                   /locus_tag="ROP_05970"
FT                   /product="methionine synthase"
FT                   /EC_number="2.1.1.13"
FT                   /note="protein synonym:5-methyltetrahydrofolate--
FT                   homocysteine methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_05970"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48844"
FT                   /db_xref="GOA:C1ASR2"
FT                   /db_xref="InterPro:IPR000489"
FT                   /db_xref="InterPro:IPR003726"
FT                   /db_xref="InterPro:IPR003759"
FT                   /db_xref="InterPro:IPR004223"
FT                   /db_xref="InterPro:IPR006158"
FT                   /db_xref="InterPro:IPR011005"
FT                   /db_xref="InterPro:IPR011822"
FT                   /db_xref="InterPro:IPR033706"
FT                   /db_xref="InterPro:IPR036589"
FT                   /db_xref="InterPro:IPR036594"
FT                   /db_xref="InterPro:IPR036724"
FT                   /db_xref="InterPro:IPR037010"
FT                   /db_xref="UniProtKB/TrEMBL:C1ASR2"
FT                   /protein_id="BAH48844.1"
FT                   /translation="MSAPFHSALLDALNQRVVIGDGAMGTMLQAADLTLDDFLGLEGCN
FT                   EILNDTRPDVLKEIHRAYFEAGADAVETNTFGCNLPNLADYDISDRIRELAEKGTRLAR
FT                   EVADEMGPGRDGMGRFVLGSMGPGTKLPTLGHAPFAILRDAYAEAAMGMIDGGADAILV
FT                   ETCQDLLQVKAAILGSQRAMETLGSRLPIITHVTVETTGTMLLGSEIGAALTALEPLGI
FT                   DMIGLNCATGPAEMSEHLRHLSKYSSLPVSVMPNAGLPQLGPNGAEYPLTAEELAEALS
FT                   GFVTEFGLGLVGGCCGTTPEHIRQVADAVRLVEKAARNPVHESGTSSLYTAVPFEQDAS
FT                   ILMIGERTNSNGSKAFREAMIAEDYQKCLDIAKDQTRDGAHMLDLNVDYVGRDGAADMA
FT                   ALASRFATSSTLPIMLDSTEPAVLQAGLEHLGGRCAVNSVNYEDGDGPDSRFQKIMRLV
FT                   KEHGAAVVALTIDEEGQARTAEHKVRIAERLLEDITVNWGLDESDIIIDALTFPISTGQ
FT                   EEVRRDGIETIEAIRELKKRHPRVHFTLGVSNISFGLNPAARQVLNSVFLHECTEAGLD
FT                   TAIVHASKILPMARIPDEQRETALDLVYDRRREGYDPLQKLMELFEGVSAASARESRAQ
FT                   ELAALPLFERLERRIVDGERNGLDDDLTAAMEEKPPLAIINETLLSGMKTVGELFGSGQ
FT                   MQLPFVLQSAEVMKAAVAYLEPHMEATDEDGKGRIVIATVKGDVHDIGKNLVDIILSNN
FT                   GYDVVNLGIKQPIATILDAAIEQKADVIGMSGLLVKSTVVMKDNLQELNAKGVAEKFPV
FT                   LLGGAALTRSYVENDLAEVYEGDVSYARDAFEGLHKMDEIMAVKRGGAPDPDSPEAIAA
FT                   REKAAERKARHERSKRIAEKRKAAEVPVELPERSDVATDIAVPSPPFWGNRIVKGVSLS
FT                   DYSGLLDERALFLGQWGLRGQRSGDGPTYEELVETEGRPRLRYWLDRLSTEGILAHAAV
FT                   VYGYFPAVSEGDDVVVLTDPTPDAEERFRFTFPRQHRDRFLCVADFVRSRTEAKETGQV
FT                   DVFPMQLVTMGQPIADFANELFAANAYRDYLEVHGIGVQLTESLAEYWHQRVREELVLP
FT                   GGHNVGEQDPSEVSGFFDLAYRGARYSFGYGACPNLEDRAKMVALLEPERIGVKLSEEL
FT                   QLHPEQSTDAFVLHHPEAKYFNV"
     atgtctgcgc catttcactc tgccctgctc gatgcgttga accagcgcgt tgtcatcggc        60
     gacggagcca tgggcaccat gttgcaggcc gcggacctca cgctcgacga cttcctcggg       120
     ctcgaaggct gcaacgaaat tctcaacgac acccgccctg acgtgctgaa agagatccac       180
     cgcgcgtatt tcgaggccgg ggccgacgcc gtcgagacca acacgttcgg gtgcaacctc       240
     cccaacctcg ccgattacga catttcggac cgtatccggg aactggccga gaagggcacc       300
     cggctggcgc gtgaggtcgc cgacgagatg gggccgggac gcgacggcat gggccgcttc       360
     gtcctcggct cgatgggccc cggaaccaag ttgccgacgc tcggccacgc gccgttcgcg       420
     atcctgcgcg acgcctacgc ggaggccgcg atgggcatga tcgacggggg cgccgacgcg       480
     attctcgtcg agacctgcca ggacctgctg caggtgaagg cggccatcct gggcagtcag       540
     cgggcgatgg agacgctggg gtcacggctc ccgatcatca cccatgtcac ggtcgagacc       600
     accggcacga tgctgctcgg cagcgagatc ggtgccgcgc tgaccgcgct cgagccgctc       660
     ggcatcgaca tgatcgggct caactgcgcg accggtcccg ccgagatgag cgaacatctc       720
     cgccacctgt ccaagtacag ctcccttccc gtgtcggtga tgcccaacgc cggactgccg       780
     cagctcggcc cgaacggcgc cgagtacccg ctcaccgcgg aggaactcgc cgaggcgctc       840
     agcggcttcg tcaccgagtt cggtctcggt ctggtcggcg gctgctgcgg caccaccccg       900
     gagcacatcc gtcaggtcgc cgacgcggtc cgcctggtcg agaaggccgc gcgcaacccg       960
     gtgcacgagt cggggacgtc gtcgctgtac acggcggtgc cgttcgagca ggacgccagc      1020
     atcctgatga tcggtgagcg cacgaactcc aacggctcca aggcatttcg tgaggcgatg      1080
     atcgccgagg actaccagaa gtgcctcgac atcgcgaagg atcagacccg cgacggcgcc      1140
     cacatgctcg acctcaacgt cgactacgtc ggacgcgacg gcgcggccga catggccgcc      1200
     ctcgcgagcc ggttcgcgac gtcgtcgacg ctgccgatca tgctcgactc caccgagccc      1260
     gcggtcctgc aggccggtct cgaacacctc ggcggccggt gcgccgtcaa ctccgtcaac      1320
     tacgaggacg gcgacggacc ggactcgcgg ttccagaaga tcatgcggct cgtcaaggag      1380
     cacggcgccg ccgtcgtcgc gctgaccatc gacgaggagg gccaggcccg caccgccgag      1440
     cacaaggtcc gcatcgccga gcgcctgctc gaagacatca ccgtgaactg gggtctcgac      1500
     gagtccgaca tcatcatcga cgcgctgacc ttcccgatct ccaccggtca ggaggaggtc      1560
     cgccgcgacg gcatcgagac gatcgaggcg atccgcgaac tgaagaagcg gcacccgcgg      1620
     gtgcacttca cgctcggcgt gtccaacatc tcgttcggcc tcaacccggc cgcccggcag      1680
     gtcctgaact cggtgttcct gcacgagtgc acagaggcgg gcctggacac ggccatcgtg      1740
     cacgcgtcga agatcctgcc gatggcgcgg atccccgacg aacagcgcga aaccgcactc      1800
     gacctggtct acgaccgccg tcgcgagggc tatgacccgc tgcagaagct gatggaactg      1860
     ttcgagggcg tctcggcggc gtcggcgcgc gaatcccgcg ctcaggaact ggcggcgctg      1920
     ccgctgttcg agcggctgga acggcgcatc gtcgacggtg agcgcaacgg cctcgacgac      1980
     gacctcaccg cggcgatgga agagaagccg ccgctcgcga tcatcaacga gaccctgctg      2040
     tccggcatga agaccgtcgg cgaactcttc gggtccgggc agatgcagtt gccgttcgtg      2100
     ctgcagtccg ccgaggtgat gaaggcggcc gtggcgtacc tcgaaccgca catggaggcc      2160
     accgacgagg acggcaaggg ccgcatcgtc atcgccaccg tgaagggcga cgtccacgac      2220
     atcggcaaga acctcgtcga catcatcctc agtaacaacg gatacgacgt ggtgaacctc      2280
     ggcatcaagc agccgatcgc caccatcctc gacgcggcga tcgagcagaa ggccgacgtc      2340
     atcggcatgt ccggtctgct cgtgaagtcc accgtggtga tgaaggacaa cctgcaggaa      2400
     ctcaacgcca agggtgtcgc ggagaagttc cccgtcctcc tcggcggtgc cgcgctgacc      2460
     cgctcgtacg tggagaacga cctggccgag gtgtacgagg gcgacgtcag ctatgcgcgc      2520
     gacgcgttcg agggcctgca caagatggac gagatcatgg ccgtcaagcg gggcggcgca      2580
     ccggacccgg acagcccgga agcgatcgcg gcccgcgaga aggcggccga acgtaaggcc      2640
     cgccacgagc ggtccaagcg gatcgcggag aagcgcaagg ccgccgaggt cccggtcgag      2700
     ctgccggagc ggtccgacgt ggccaccgac atcgcggtcc cgagcccgcc gttctggggc      2760
     aaccggatcg tgaagggcgt gtcgctgtcg gactactcgg gcctgctcga cgagcgcgcc      2820
     ctgttcctcg ggcagtgggg cctgcgcggg cagcgttccg gcgacggtcc cacatacgag      2880
     gaactggtgg agaccgaggg ccggccccgg ctgcggtact ggctcgaccg gctcagcacc      2940
     gagggaatcc tcgcgcacgc cgcggtggtg tacggctatt tccccgccgt gtccgagggt      3000
     gacgacgtgg tcgtgctcac cgacccgacg cccgacgcgg aggaacggtt ccggttcacg      3060
     ttcccgcgcc agcaccgcga ccggttcctg tgcgtcgccg acttcgtccg gtcccgcacc      3120
     gaggcgaagg agaccggtca ggtcgacgtg ttcccgatgc agctggtcac catggggcag      3180
     ccgatcgcgg acttcgcgaa cgaactgttc gccgccaacg cgtaccgcga ctacctcgag      3240
     gtgcacggca tcggcgtgca gttgacggag tcgctggccg agtactggca tcagcgggtc      3300
     cgtgaggaac tcgtgctgcc cggcggccac aacgtcggcg agcaggatcc gtcggaggtg      3360
     tccggattct tcgacctcgc ctaccgcggc gcccgttact ccttcgggta cggcgcctgc      3420
     cccaacctgg aggaccgcgc gaagatggtc gctctcctcg aaccggaacg gatcggtgtg      3480
     aaattgtcgg aggaactgca gttgcatccc gagcagtcca cggatgcatt cgtgctgcac      3540
     caccccgaag cgaagtactt caatgtctga                                       3570
//

If you have problems or comments...

PBIL Back to PBIL home page