(data stored in ACNUC7421 zone)

EMBL: AP011115.MREB

AP011115.MREB        Location/Qualifiers
FT   CDS_pept        389673..390662
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mreB"
FT                   /locus_tag="ROP_03780"
FT                   /product="putative rod shape-determining protein MreB"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_03780"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48625"
FT                   /db_xref="GOA:C1ARE8"
FT                   /db_xref="InterPro:IPR004753"
FT                   /db_xref="UniProtKB/TrEMBL:C1ARE8"
FT                   /protein_id="BAH48625.1"
FT                   /translation="MGGLGIDLGTANTVVGTPDDGIVLNEPSFMLVRTKEPHRALAIGS
FT                   EARSLVGRTPIGITPVRPLRDGVIVDLESARAFVTAIVKRVSPARRYGVRPKAVISVPA
FT                   GATPLERRALLEVGHEAGLRKVGLVPEPVAGALGCGINPLEPRAHLVVDIGGGTSEITA
FT                   ICFGGILSHRSCRLAGDELTNALYQYLRAEHNIVVGELTAERAKLGAPDTDEGQSLVVE
FT                   GRDAVTGRARFVTLETEEIVDALRPTTTGIVHTLTECLEDLPPQAIGDVMSEGLLVIGG
FT                   GALLRGLSQLLEEAFGFPVKTAERPLTCVAEGATACLVHPEVVAAYSS"
     gtgggtggac ttggtatcga tctcggaact gccaacactg tcgtcggaac ccccgacgac        60
     ggcatcgtac tgaacgagcc ttccttcatg ctggttcgga cgaaggaacc gcaccgcgct       120
     ctcgccatcg gcagcgaggc gcgcagtctc gtcggccgga cgcccatcgg aataactccg       180
     gtgcggccgc tgcgggacgg ggtgatcgtg gacctcgagt cggcgcgggc cttcgtgacg       240
     gcgatcgtca aacgggtgtc gccggcccgg cgttacgggg tgcggcccaa ggccgtcatc       300
     tcggtgcctg ccggcgccac tccgctcgag cgcagggccc tgctcgaggt cggtcacgag       360
     gccggcctgc ggaaggtggg gctggtgccc gagccggtcg cgggcgccct cggctgcgga       420
     atcaacccgc tcgaaccccg cgcccatctc gtcgtcgaca tcggcggcgg cacttcggaa       480
     atcaccgcca tatgtttcgg cggcattctc tcccaccgca gttgccgact cgcgggcgac       540
     gaactgacca acgcgctgta ccagtacctg cgggcggagc acaacatcgt cgtcggcgaa       600
     ctcaccgccg aacgggcgaa gctgggcgcg ccggacaccg acgaaggtca gtcactcgtc       660
     gtcgagggcc gcgacgccgt caccggccga gcacgcttcg tcaccctcga aaccgaggag       720
     atcgtggatg cgttgcggcc gaccacaacc ggaatcgttc acaccctgac cgagtgcctc       780
     gaagaccttc cgccccaggc gatcggcgac gtgatgtcgg aggggttgct cgtcatcggc       840
     ggcggggcgt tgctgcgtgg cctctcgcag ctgctcgagg aggcgttcgg attcccggtg       900
     aagacggccg aacgcccact cacgtgtgtc gcggaaggtg ccaccgcgtg tctcgtgcat       960
     cccgaggtgg tcgccgccta cagcagctga                                        990
//

If you have problems or comments...

PBIL Back to PBIL home page