(data stored in ACNUC7421 zone)

EMBL: AP011115.NASD

AP011115.NASD        Location/Qualifiers
FT   CDS_pept        619449..621614
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nasD"
FT                   /locus_tag="ROP_06000"
FT                   /product="nitrite reductase large subunit"
FT                   /EC_number="1.7.1.4"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_06000"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48847"
FT                   /db_xref="GOA:C1ASR5"
FT                   /db_xref="InterPro:IPR005117"
FT                   /db_xref="InterPro:IPR006066"
FT                   /db_xref="InterPro:IPR006067"
FT                   /db_xref="InterPro:IPR007419"
FT                   /db_xref="InterPro:IPR012744"
FT                   /db_xref="InterPro:IPR016156"
FT                   /db_xref="InterPro:IPR023753"
FT                   /db_xref="InterPro:IPR036136"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="InterPro:IPR041575"
FT                   /db_xref="InterPro:IPR041854"
FT                   /db_xref="UniProtKB/TrEMBL:C1ASR5"
FT                   /protein_id="BAH48847.1"
FT                   /translation="MLIVATGSNTFFPNMDGLREHDGRLARGVFGFRNIADTNGMLQMA
FT                   QAHDDVSAVVIGGGLLGLEAAYGLRTQGLTVDVVHSPGHLMNQQLDERGGSVLRAEIEK
FT                   LGVGVHTSMRTTAVLRDDAGLVTGVSFVDGSTLDADMVVVTAGIRPNTELARAAGLVVE
FT                   RGIVVDDQMRCEDEGSVYAVGECAQHRGETYGLVAPVWEQAVILADVLTGSDPEAAYVG
FT                   SRTTTQLKVAGVDVAAMGVKGPETADDEFVQYYEPRSGTYKSLVVRDGKLIGATLMGDI
FT                   SKAGFLTQAFDGKVPLPEERISMLFDVGTPAAATSVADLPDDLQVCNCNGVSKGDLVAC
FT                   VHSGAKTLTDVCATTRAGKGCGSCKGLVADIVACAAGGELEADPSADWYVPCIPMSKPE
FT                   LTAAIRERDLRAVSQVFAELATDANEDASAKMPLASLLRTIWGPDWVDERGALFINDRV
FT                   HANIQRDGTFSVVPQMKGGVTTPDQLRRIADVADKYRVPLVKVTGGQRIDLLGIKKEDL
FT                   PKVWGDLDMPSGFAYGKSMRTVKTCVGTDFCRYGLGDSTSLGIALEERFQGLETPAKLK
FT                   LAVAGCPRNCSEALCKDFGVVAVGDGRWEIYVGGAAGAHIRKGDLLATVESPDAVVELG
FT                   GRFIQYYRENAKWLERTYDFVPRVGLEHLQALLVRDEEDIVTGLDERIQTAVDGYRDPW
FT                   KERSAPKSPAQFAPSLPLLPLPQVPVR"
     gtgctgatcg tcgccacggg aagcaacacg ttctttccca acatggacgg actgcgggag        60
     cacgacggtc gcctggcccg cggggtgttc ggattccgca acatcgccga caccaacggg       120
     atgctgcaga tggcacaggc acacgacgac gtgtccgcgg tggtgatcgg cggcggactg       180
     ctcgggctcg aggccgcgta cgggctgcgg acgcaggggc tcaccgtcga cgtcgtgcac       240
     tcccccgggc atctgatgaa ccagcaactc gacgaacgcg gcggcagcgt cctgcgcgcc       300
     gagatcgaga aactcggtgt cggcgttcac acctcgatgc ggaccaccgc cgtgctgcgc       360
     gacgacgccg gcctggtgac cggggtgtcg ttcgtcgacg gctccacgct ggacgccgac       420
     atggtggtcg tcaccgcggg aatccggccc aacaccgaac tggcgcgggc cgcaggtctg       480
     gtggtcgagc gcgggatcgt cgtcgacgac cagatgcgct gcgaggacga gggttcggtg       540
     tacgccgtcg gcgagtgcgc gcagcaccgg ggagagacgt acggcctcgt ggccccggtg       600
     tgggagcagg cggtcatcct cgcggacgtc ctcaccggct ccgatccgga agcggcctat       660
     gtcggttcgc gcaccaccac ccagctgaag gtcgcggggg tggacgtggc cgcgatgggc       720
     gtcaaggggc cggagaccgc ggacgacgaa ttcgtccaat actacgaacc acgcagcggc       780
     acgtacaaga gtctcgtcgt ccgggacgga aagctgatcg gcgccaccct gatgggcgac       840
     atcagcaagg cgggcttcct cacgcaagcg ttcgacggca aggtgccgct gcccgaggag       900
     cgaatcagca tgctcttcga cgtcggcaca cccgccgccg cgacgagtgt cgccgacctt       960
     cccgacgacc tgcaggtgtg caactgcaac ggtgtgagca agggcgatct ggtggcctgc      1020
     gtccactccg gcgcgaagac cctcaccgac gtgtgcgcca cgacccgcgc gggcaagggt      1080
     tgtgggtcgt gcaagggact cgtcgccgac atcgtggcct gcgccgccgg cggcgaactc      1140
     gaagcggacc cctccgccga ctggtacgtg ccgtgcatcc cgatgagcaa gcccgagctc      1200
     accgcggcca tccgggaacg cgatctgcgc gccgtgtccc aggtgttcgc cgaactcgcg      1260
     acggacgcca acgaggacgc gtccgcgaag atgccgctcg cgtcactgct ccgcacgatc      1320
     tgggggcccg actgggtgga cgagcgcggc gcgctgttca tcaacgaccg cgtgcacgcc      1380
     aacatccagc gcgacggcac gttctcggtg gtcccgcaga tgaagggcgg tgtcaccacg      1440
     ccggaccagc tccgcaggat cgccgacgtc gccgacaagt accgcgtgcc gctcgtgaag      1500
     gtcaccggtg ggcagcgcat cgacctgctg ggcatcaaga aggaggatct ccccaaggtg      1560
     tggggcgacc tcgacatgcc gtccgggttc gcctacggca agagcatgcg cacggtgaaa      1620
     acctgtgtcg gaacggactt ctgccgctac ggtctcggcg attcgacgag cctcggcatc      1680
     gctctcgagg agcggttcca gggtctggag acgcccgcga agctgaaact cgcggtcgcc      1740
     gggtgccccc gcaactgttc cgaggccctg tgcaaggact tcggggtggt cgcggtcggc      1800
     gacggccgct gggagatcta cgtcggcggc gccgcgggcg cccatatccg caagggcgat      1860
     ctgctggcca cggtcgaatc accggacgcc gtcgtggaac tcggcgggcg gttcatccag      1920
     tactaccgcg agaacgcgaa atggctcgaa cgcacctacg atttcgtgcc gcgggtggga      1980
     ctcgaacatc ttcaggcact actggtccgg gacgaggagg acatcgtgac gggattggac      2040
     gagcggatcc agacggcggt ggacggctac cgggatccgt ggaaggagcg cagcgcgccg      2100
     aaatcgccgg cgcagttcgc tccctcgctc ccgctgctgc cgctccccca ggtgccggtc      2160
     cgatga                                                                 2166
//

If you have problems or comments...

PBIL Back to PBIL home page