(data stored in ACNUC7421 zone)

EMBL: AP011115.NASE

AP011115.NASE        Location/Qualifiers
FT   CDS_pept        621611..621937
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nasE"
FT                   /locus_tag="ROP_06010"
FT                   /product="nitrite reductase small subunit"
FT                   /EC_number="1.7.1.4"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_06010"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48848"
FT                   /db_xref="GOA:C1ASR6"
FT                   /db_xref="InterPro:IPR012748"
FT                   /db_xref="InterPro:IPR017941"
FT                   /db_xref="InterPro:IPR036922"
FT                   /db_xref="UniProtKB/TrEMBL:C1ASR6"
FT                   /protein_id="BAH48848.1"
FT                   /translation="MTALIEGPTEFAVGPVSDLTPGEGRTYVVQDRQVAVFLLSDGTVR
FT                   AMDAVCPHRGGPLADGQIDASGVMCPLHQYAFAFDTGACGSEGVGSVRTYPASVREGSV
FT                   VVHV"
     atgaccgccc tcatcgaggg tcccaccgag ttcgcggtgg ggccggtcag cgacctgact        60
     ccgggcgagg gccggacgta cgtcgtgcag gaccggcagg tggccgtatt cctgctgtcg       120
     gacggcaccg ttcgggcgat ggacgcggtg tgcccgcaca ggggcggccc cctcgcggac       180
     gggcagatcg acgcctccgg cgtgatgtgc ccgctccacc agtacgcgtt cgccttcgac       240
     acgggcgcct gcggatccga gggtgtgggc tcggtccgca cgtacccggc atcggtccgc       300
     gaggggtcgg tcgtcgtgca cgtgtga                                           327
//

If you have problems or comments...

PBIL Back to PBIL home page