(data stored in ACNUC7421 zone)

EMBL: AP011115.OTSA

AP011115.OTSA        Location/Qualifiers
FT   CDS_pept        186019..187461
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="otsA"
FT                   /locus_tag="ROP_02140"
FT                   /product="putative alpha,alpha-trehalose-phosphate
FT                   synthase"
FT                   /EC_number="2.4.1.15"
FT                   /note="protein synonym:trehalose-6-phosphate synthase"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_02140"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48461"
FT                   /db_xref="GOA:C1ASL2"
FT                   /db_xref="InterPro:IPR001830"
FT                   /db_xref="UniProtKB/TrEMBL:C1ASL2"
FT                   /protein_id="BAH48461.1"
FT                   /translation="MNDSAPHGTSDFVVVANRLPVDMETLDDGTTRWKRSPGGLVTALE
FT                   PILLGRERGSWVGWPGVPDTKVEPIVSGGVDLFPVELSSDEVARYYEGFSNATLWPLYH
FT                   DVLVAPVFDRDWWHTYLEVNRHFAEETARTAAEGATVWVQDYQLQLVPRLLREMRPDLT
FT                   IGFFLHIPFPPVELFMQLPWRKEIVEGLLGADLIGFHLPGGAHNFLFLARRLLGLDATT
FT                   AGVGVRGALGTVTLDDRVVHVGAFPISVDARKLVEQATEPAVVERAAEIRRELGNPRKI
FT                   LLGVDRLDYTKGIDLRLSALGELLDEGRLDPSDTVMVQLATPSRERVEHYMKMRSSIEE
FT                   QVSHINGDHGQIGRPVVHYLYQPVDRSELIALFLAADVMLVTPMRDGMNLVAKEYVACR
FT                   ADLGGALVLSEFAGAAAELRGAYLVNPHDLDGVKNTIVAALGQEREQGRRRMSRLHRQV
FT                   LDHDVHRWAQSFLGALDPNAAD"
     gtgaacgatt ctgctccgca cggcacgtcc gacttcgtgg tcgtcgccaa ccggctgccc        60
     gtggacatgg agacactcga cgacggaacg acacgctgga aacgcagtcc cggagggctc       120
     gtcaccgccc tggaaccgat cctcctcgga cgggagcgcg gatcctgggt gggctggccg       180
     ggggtgcccg atacgaaggt cgaaccgatc gtctccggtg gggtcgatct gttcccggtg       240
     gaactgagtt cggacgaggt ggcccggtac tacgaggggt tctcgaacgc gacgctgtgg       300
     ccgctgtacc acgacgtgct ggtggccccg gtgttcgacc gggactggtg gcatacctac       360
     ctggaggtga atcgccactt cgcggaggag acggcgcgca ccgccgccga gggcgccacg       420
     gtgtgggtgc aggattatca actccagctg gtgccgcgcc tgctccggga gatgcgcccc       480
     gatctgacca tcggattctt tcttcacatc ccgttcccgc cggtcgaatt gttcatgcag       540
     ctgccgtggc gaaaggagat cgtggagggg ctcctcgggg ccgacctcat cggtttccat       600
     ctgcccgggg gcgcccacaa cttcctgttc ctggcccgca gactgctcgg actcgacgcc       660
     accaccgcgg gcgtcggcgt gcgcggcgca ctcggcacgg tgacactcga cgaccgagtc       720
     gtgcacgtcg gcgccttccc catctccgtc gacgcccgga aactcgtcga acaggcgacc       780
     gagcccgccg tcgtcgaacg ggccgcggag atccgccggg agctcgggaa cccacggaag       840
     atcctcctcg gcgtcgaccg actcgattac acgaagggca tcgacctgcg gctgtcggcg       900
     ctcggtgaac tgctcgacga ggggcggctc gacccgtccg acaccgtgat ggtgcaactc       960
     gccaccccca gccgtgaacg cgtcgagcac tacatgaaga tgcgcagctc catcgaggag      1020
     caggtcagcc acatcaacgg cgaccacggg cagataggcc ggccggtggt gcactacctc      1080
     taccagccgg tcgatcgcag cgagctgatc gcgctgttcc tcgccgccga cgtcatgctc      1140
     gtcaccccga tgcgcgacgg gatgaatctc gtggccaagg agtacgttgc ctgccgggcc      1200
     gacctgggcg gtgcgctggt actcagcgaa ttcgcgggtg ccgccgccga actccggggc      1260
     gcctacctgg tgaacccgca cgacctcgac ggggtgaaga acacgatcgt ggccgcactc      1320
     ggccaggagc gagagcaggg acggcgaaga atgtcgcggc tgcaccggca ggtgctcgac      1380
     cacgacgtgc accggtgggc gcaatccttc ctcggagcac tcgacccgaa cgcggccgac      1440
     tga                                                                    1443
//

If you have problems or comments...

PBIL Back to PBIL home page