(data stored in ACNUC7421 zone)

EMBL: AP011115.PE1

AP011115.PE1         Location/Qualifiers
FT   CDS_pept        899..1303
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_00010"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_00010"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48248"
FT                   /db_xref="GOA:C1ARZ9"
FT                   /db_xref="InterPro:IPR004176"
FT                   /db_xref="InterPro:IPR036628"
FT                   /db_xref="UniProtKB/TrEMBL:C1ARZ9"
FT                   /protein_id="BAH48248.1"
FT                   /translation="MPAHRQAPPLPQGTSRTPAKTKKVLEASLRQTTLLGHEKIGTNHL
FT                   LLALLDDPASTGTQILTDLASLPISEMHEHLRRELAQQPTPGPAHRIPIRLSNDKYTRA
FT                   HAAAHTAGQNLETSGPRPHHRRPRTTRIAG"
     gtgccagcgc accggcaggc tccgcccctg ccgcagggca catcccgaac accggcgaag        60
     acgaagaagg tcctcgaagc cagcctgcgc cagaccaccc tgctcgggca cgagaagatc       120
     ggcaccaacc acctcctcct ggccctgctc gacgaccccg cctccaccgg cactcaaatc       180
     ctcaccgacc tcgcatccct gcccatcagc gagatgcatg agcacctcag acgcgaactg       240
     gcccagcagc ccaccccagg ccccgcccac cgcatcccca tccgactcag caacgacaaa       300
     tacacccgcg cccacgccgc cgcccacacc gccggccaga acctcgaaac ctccggtcca       360
     cgaccgcatc accgacgccc tcgaacaacc cgaatagcag gttga                       405
//

If you have problems or comments...

PBIL Back to PBIL home page