(data stored in ACNUC7421 zone)

EMBL: AP011115.PE10

AP011115.PE10        Location/Qualifiers
FT   CDS_pept        9611..9928
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_00100"
FT                   /product="hypothetical membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_00100"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48257"
FT                   /db_xref="GOA:C1AS08"
FT                   /db_xref="UniProtKB/TrEMBL:C1AS08"
FT                   /protein_id="BAH48257.1"
FT                   /translation="MTATGRPGAARWKAVGVGGAAVGACAVCCAGPILSVLGGLTAAFA
FT                   LGALWVPALAVVALVAAVALGWTLRRRRSAPASCPPAPAADLPMPTIPGALEERTAPEP
FT                   R"
     atgacggcga ccggccgacc cggggccgcg cggtggaagg cagtcggggt gggcggcgcc        60
     gcggtcgggg cgtgcgcggt gtgctgcgcg ggaccgatcc tgtcggtcct gggcggactg       120
     acagcggcgt tcgcgctcgg ggcgctgtgg gtgcctgccc tggccgtggt ggcgctcgtc       180
     gccgcagtcg cactgggctg gacgctccgt cgtcgacgct ccgcacccgc gtcctgcccg       240
     cccgcgccgg ccgcggatct gccgatgccc acaattcccg gcgccctgga ggagcggacc       300
     gcacccgagc cacgatga                                                     318
//

If you have problems or comments...

PBIL Back to PBIL home page