(data stored in ACNUC7421 zone)

EMBL: AP011115.PE101

AP011115.PE101       Location/Qualifiers
FT   CDS_pept        84249..85691
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_01010"
FT                   /product="putative amino acid transporter"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_01010"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48348"
FT                   /db_xref="GOA:C1AS99"
FT                   /db_xref="InterPro:IPR002293"
FT                   /db_xref="UniProtKB/TrEMBL:C1AS99"
FT                   /protein_id="BAH48348.1"
FT                   /translation="MSATNPPSKSMGAGIADSSATAATADETSAEDTGRLSPTALVSLS
FT                   LASFFPAVSFAMVPFLVFTTSGTNAWQSSLLATIGVICIGRAVIAFARRYVASGSLYSY
FT                   VGEVFGPWARHLTAASLLAGFIVGVAALAAVVGVFVGSFLHARGIHGALNFDTQVIVFG
FT                   LALVLAAAVAIRGLDTSVMVAVTLAVIALPLVLIITVASAAHTGLDLGTQFSFTGFEVG
FT                   PVFQGIAVGAAFLVGFESCAALATETKDPKHSVPTAIMAVPVILGGLFPIVTILQVPGL
FT                   IATSDELAAGVSAPAALAQLSGLGHGVATATDLVLAAASFASLVGFLNYAARFTMTLSE
FT                   DGLLPSVFSRLHPKHKSPSAAVLLMTLCAFLTISGMLLWTGDIISAYTPNATLLVYMWV
FT                   VPYVIICVGAIRLSIRLREFRPGLWIAAVAGAATMTWAYTNGLVNPPPAPADSMIWVAP
FT                   VAIALLFGVVRINVSRTRHIAE"
     atgtccgcta ccaatccccc atcgaagtcg atgggcgccg gtatcgccga ttcctccgca        60
     actgctgcca ccgccgacga gacctccgcc gaagacaccg gccgtctcag ccccaccgcg       120
     ctggtgtcgc tctccctcgc ctcattcttt cccgcagtgt cgttcgcgat ggtgcccttc       180
     ttggtcttca cgacgagcgg caccaatgca tggcagtcgt cgctgctcgc aacgatcggt       240
     gtgatctgca tcggtcgcgc agtgatcgcg ttcgctcgcc gttacgtcgc ctccggttcg       300
     ctctactcgt acgtcggtga agtgttcggc ccgtgggccc gccatctcac ggccgcgtcg       360
     ctactcgccg ggttcattgt cggcgtcgcg gcgctcgccg ccgtcgtcgg cgtgttcgtc       420
     ggcagtttcc tccacgcgag gggcatccac ggcgcattga acttcgacac tcaggtcatc       480
     gtgttcggac tcgcgctggt ccttgccgcc gctgtcgcca tccggggtct cgacacgtcc       540
     gtcatggtcg ctgtcacgct tgcggtgatc gcccttccac tggtcttgat catcaccgtg       600
     gcgagtgccg cacacaccgg actcgacctc ggcacgcaat tcagcttcac cggcttcgaa       660
     gtgggcccgg tgttccaggg gatcgcggtg ggcgccgcgt tcctcgtagg cttcgagagc       720
     tgcgcggcac tggccaccga gaccaaggac cccaagcaca gcgtacccac ggcgatcatg       780
     gcagtgccgg taatcctcgg cggcctgttc ccgatcgtga cgattctgca ggtccccggg       840
     ctcatcgcga cgtccgacga gctggccgcc ggtgtctccg ctccggctgc tctggctcaa       900
     ctttcaggtc tcggtcacgg ggtcgcaacc gccacagatc tggttctcgc cgcggcctcg       960
     ttcgcctcgc tggtcggatt cttgaactac gccgcccgat tcacgatgac actgtccgag      1020
     gacggcctcc tgccctccgt gttctctcgc ctccatccca agcacaagag tccttccgcc      1080
     gccgtcctgc tgatgacgtt gtgcgcgttc ctgacgatct ccgggatgct gctctggaca      1140
     ggcgacatca tctccgccta cacgcccaac gcgacgctgc tcgtgtatat gtgggtcgtg      1200
     ccctacgtga tcatctgcgt gggtgccatc aggctgtcga ttcggctgcg tgagttccgg      1260
     ccggggctgt ggatcgccgc cgtcgccggt gctgcgacga tgacgtgggc ctacacgaac      1320
     ggtctggtca acccgccgcc ggcgccggcg gactcgatga tctgggtcgc acccgtggcg      1380
     atcgccctgc tcttcggcgt cgtcaggatc aatgtgtcga ggacacgtca catcgccgag      1440
     tag                                                                    1443
//

If you have problems or comments...

PBIL Back to PBIL home page