(data stored in ACNUC7421 zone)

EMBL: AP011115.PE105

AP011115.PE105       Location/Qualifiers
FT   CDS_pept        complement(88632..89075)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_01050"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_01050"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48352"
FT                   /db_xref="InterPro:IPR032710"
FT                   /db_xref="InterPro:IPR037401"
FT                   /db_xref="UniProtKB/TrEMBL:C1ASA3"
FT                   /protein_id="BAH48352.1"
FT                   /translation="MTEKSESTEMLDRYCAVIRELCDAVAAHDTDHMLRYFDDSCVFVN
FT                   GVDGRHTAKDGLVEFFQQVWESFPDYAPVPVEMHLNGDVLAVIFRTTATVRVGESEQIV
FT                   SWLMTSFSTFDPETVTIVRDVYFADEEALEETIQRLHEAATVQ"
     atgaccgaga aatctgaatc aacagagatg ctcgaccggt attgcgcagt gatcagggag        60
     ttgtgcgatg ctgtcgccgc tcacgacacc gaccacatgc tccgctactt cgacgactcc       120
     tgtgtgttcg tcaacggcgt ggacggacga cacaccgcga aagacgggtt ggtcgagttc       180
     ttccagcaag tctgggagtc gttccccgat tacgctccgg tgcccgtcga gatgcacctg       240
     aacggggatg tcctcgcggt gatcttccgg acgacggcga ctgttcgtgt cggggaatcc       300
     gagcagatcg tcagctggct gatgacgtcg ttctcgacgt tcgacccgga gaccgtcaca       360
     atcgtgcgcg acgtctattt cgcagacgaa gaagcgctcg aagagacgat tcagcgcctt       420
     cacgaggccg cgacggtcca gtga                                              444
//

If you have problems or comments...

PBIL Back to PBIL home page