(data stored in ACNUC7421 zone)

EMBL: AP011115.PE109

AP011115.PE109       Location/Qualifiers
FT   CDS_pept        complement(93353..93766)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_01090"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_01090"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48356"
FT                   /db_xref="InterPro:IPR010424"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="UniProtKB/TrEMBL:C1ASA7"
FT                   /protein_id="BAH48356.1"
FT                   /translation="MKAASTDHETNYGEGIVVENNPQPVVAIQQDRYTFDNGPMKLELR
FT                   SARTGIDQLAGGILRFDDGGAGEPWKLPYDEMLYVITGTLRLRFADQILSLAPGEVAAI
FT                   PRGAEVVYEGEPGTTAFYALTPADWHVEHPDGL"
     gtgaaagcag cgagcaccga ccacgaaacg aactacggag aaggaatagt cgtggaaaac        60
     aacccgcaac ccgtcgtcgc gatccagcag gatcggtaca ccttcgacaa cggtccaatg       120
     aaactcgaac tgcgcagtgc gcgaacaggt atcgaccagc tggcgggagg cattctgcgg       180
     ttcgacgacg gtggtgccgg cgagccctgg aagcttccgt acgacgagat gctgtacgtg       240
     atcacgggaa ccctccggct gcgtttcgcc gaccagatcc tctcgctggc gccgggcgag       300
     gtcgcggcca tcccccgcgg cgcagaagtg gtctacgagg gtgaacccgg caccacggcc       360
     ttctacgcgc tgacgcccgc cgactggcac gtcgagcatc cggacggact gtag             414
//

If you have problems or comments...

PBIL Back to PBIL home page