(data stored in ACNUC7421 zone)

EMBL: AP011115.PE11

AP011115.PE11        Location/Qualifiers
FT   CDS_pept        10019..11014
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_00110"
FT                   /product="hypothetical membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_00110"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48258"
FT                   /db_xref="GOA:C1AS09"
FT                   /db_xref="InterPro:IPR002657"
FT                   /db_xref="InterPro:IPR004706"
FT                   /db_xref="InterPro:IPR038770"
FT                   /db_xref="UniProtKB/TrEMBL:C1AS09"
FT                   /protein_id="BAH48258.1"
FT                   /translation="MTQPQGVVARMEHHQVAIYLAAMVAGAGIGWAAPAAGPGLEHAIN
FT                   PVLGALLFVTFLQVPVAELLRSLRDGRFLTAILAVNFVVVPLVVAAMFTFLPADQAVRI
FT                   GVLLVLLCPCVDYVIVFSGLAGGSSRRLLAATPLLLLTQMLLLPVFLVLFLGSDLSDIV
FT                   EVGPFVTAFIVLIVIPLALAWATQFWASRAESGRRTSEAATSLMVPLMAATLLVVVASQ
FT                   VPKLEGRVADVAAVVPFYVVFLVVMAFAGMLVARLFRLDPPSGRAVVFSGATRNSLVVL
FT                   PLALALPDQLAVAAVVVVTQTLVEVVGMVVYVRLVPRLLPAATDTSPAPA"
     gtgacgcagc cgcagggtgt ggtcgcacga atggaacatc accaggtggc gatctacctc        60
     gcggcgatgg tcgccggcgc cgggatcggc tgggccgcac cggcagcggg acccggtctc       120
     gagcacgcga tcaacccggt cctcggtgcg ctgctgtttg tgacgttcct gcaggtgccg       180
     gtcgccgaac tgctgcggtc cctgcgcgac ggccggttcc tgacggccat cctggcggtc       240
     aacttcgtgg tcgttccgct cgttgtcgcc gcgatgttca ccttcctccc cgccgatcag       300
     gccgtgcgga tcggggtgct gctggtgttg ctgtgcccgt gtgtggacta cgtgatcgtc       360
     ttctccgggc tggcgggcgg cagtagccgc cgcctgctcg ccgcgacccc gctgctgctg       420
     ctcacccaga tgctgctgct cccggtgttt ctcgtgctgt tcctgggttc ggacctgtcc       480
     gacatcgtcg aggtcggccc gttcgtcacc gcgttcatcg tcctgatcgt catccccctc       540
     gcgctggcgt gggccaccca gttctgggcg tcgcgtgcgg aatccgggcg gaggacatcg       600
     gaggcggcga cctcgctgat ggtgccgctg atggccgcca ccctgctggt ggtggttgcc       660
     tcccaggtgc ccaagctcga gggccgggtc gccgatgtgg ccgcggtggt gcccttctac       720
     gtggtgttcc tggtggtgat ggcgttcgcg ggaatgctgg tcgcccggct gtttcggttg       780
     gacccgccgt ccgggcgggc ggtggtgttc agcggagcca cccgcaactc cctggtcgtg       840
     ctcccgctgg ctctggcact gcccgaccag ctggcggtcg ccgcggtcgt cgtggtcacc       900
     cagaccctgg tcgaggtcgt cggcatggtc gtctacgtcc gcctggtgcc gcgcctgctg       960
     cccgcggcca cggatacctc tccggcaccg gcctga                                 996
//

If you have problems or comments...

PBIL Back to PBIL home page