(data stored in ACNUC7421 zone)

EMBL: AP011115.PE110

AP011115.PE110       Location/Qualifiers
FT   CDS_pept        complement(93767..94567)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_01100"
FT                   /product="putative gluconate 5-dehydrogenase"
FT                   /EC_number="1.1.1.69"
FT                   /note="protein synonym:5-keto-D-gluconate 5-reductase"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_01100"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48357"
FT                   /db_xref="GOA:C1ASA8"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:C1ASA8"
FT                   /protein_id="BAH48357.1"
FT                   /translation="MPISEALAPDETGPGIFDLTERRVIVTGASRGLGRQLARGLAAFG
FT                   ASVACVARDQAALDETVALIEAQGGKASAYVADLGDPDAVTSLIERVAIDMGGIDVLLN
FT                   NAGVDHDSPIEETSLETWEKVIEVNNRSVFLMIQAASPYLRASGGYGKVINIASILGTV
FT                   AMRDNSAYVMSKHAAIGLTKSIALEWGRRGVQVNALCPGFLVTDMTIHSVSDEASSKWI
FT                   TSRTPMGRWGQPSDYVGAAVFLASRASDFMTGQTLYIDGGWTAQ"
     atgccgatca gcgaagcact cgcaccggac gagaccgggc ccggaatctt cgacctcacg        60
     gaacgacgag taatcgtcac gggtgcgtcc cgcggcctcg gacgccagct ggcgcggggt       120
     ctcgcggcgt tcggcgcctc ggtggcctgc gtggcccgcg accaggccgc cctggacgag       180
     accgtggccc tcatcgaggc tcagggcggg aaggcatcgg cgtacgttgc cgacctggga       240
     gatcccgacg cagtgacatc gctcatcgag cgagtcgcca tcgacatggg aggcatcgac       300
     gtcctcctca acaatgccgg tgtcgatcac gactcgccga tcgaagagac gagcctggag       360
     acctgggaaa aggtgatcga ggtcaacaat cggtcggtat ttctgatgat tcaagccgcc       420
     tccccgtacc tccgggcctc gggcggctac ggcaaggtca tcaatatcgc gtcgatcctc       480
     ggcaccgtcg cgatgcgcga caactccgcg tacgtcatgt cgaagcatgc ggcgatcggt       540
     ctgaccaagt cgatcgccct cgagtggggt cgtcgcggcg tccaggtcaa cgcactgtgc       600
     cccggcttcc tggtcacgga catgaccatc cactccgtca gcgatgaagc ctccagtaag       660
     tggatcactt cgcgcacacc gatggggcgc tggggccagc cgagcgatta cgtcggcgcg       720
     gcagtgttcc tcgcatcacg agcttcggac ttcatgacag gccagacgct gtacatcgac       780
     ggcggctgga cggcccagta g                                                 801
//

If you have problems or comments...

PBIL Back to PBIL home page