(data stored in ACNUC7421 zone)

EMBL: AP011115.PE115

AP011115.PE115       Location/Qualifiers
FT   CDS_pept        101378..101827
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_01150"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_01150"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48362"
FT                   /db_xref="InterPro:IPR032710"
FT                   /db_xref="InterPro:IPR037401"
FT                   /db_xref="UniProtKB/TrEMBL:C1ASB3"
FT                   /protein_id="BAH48362.1"
FT                   /translation="MTNTENRVDTEACVERIESVCMAVVARDLEGVLDHFAEDCVFVNG
FT                   VTGTTVPGKAELVNFLNDIWASFPEYTPRPVAAHLEQTTLGMLFETTVELPATDEKASP
FT                   DGTKVRWLTSSFFTFDPTSMKIIRDVYYADEAAVEQMINEAGRAG"
     atgaccaaca cggaaaaccg ggtggacacc gaagcctgtg tggaacggat cgaaagcgta        60
     tgcatggctg ttgtcgcgcg ggacctcgaa ggcgtcctgg accacttcgc tgaggattgc       120
     gtattcgtca acggggtgac aggaactacg gtgcccggta aggcggagct cgtcaatttc       180
     ttgaacgaca tctgggcgtc gtttcccgag tacacgccac ggccggtcgc cgcgcatctg       240
     gagcagacaa cgctgggaat gctgttcgag acgactgtgg aacttcccgc gaccgatgag       300
     aaggcgtccc cagacggtac gaaggtgcgg tggctgacca gctccttctt caccttcgat       360
     cccacgtcga tgaagatcat tcgcgacgtc tactacgccg acgaggcagc tgtcgaacaa       420
     atgatcaacg aagctggacg tgccggctga                                        450
//

If you have problems or comments...

PBIL Back to PBIL home page