(data stored in ACNUC7421 zone)

EMBL: AP011115.PE116

AP011115.PE116       Location/Qualifiers
FT   CDS_pept        complement(102807..102995)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_01160"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_01160"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48363"
FT                   /db_xref="UniProtKB/TrEMBL:C1ASB4"
FT                   /protein_id="BAH48363.1"
FT                   /translation="MPPRRDSDETRFDSDEPAKKPETAGLFAGWAKADRFGIVVAKPLR
FT                   CPHSHSACRLGLPRSVR"
     atgccaccgc gacgcgactc cgacgagacg cgtttcgact cagacgaacc ggcgaagaag        60
     cccgagaccg caggcctctt cgccggttgg gccaaggcgg accggttcgg gatcgtcgtg       120
     gcgaagcccc ttcggtgccc tcattctcat tctgcttgcc gtctcggact tcctcgcagc       180
     gtgcgctga                                                               189
//

If you have problems or comments...

PBIL Back to PBIL home page