(data stored in ACNUC7421 zone)

EMBL: AP011115.PE119

AP011115.PE119       Location/Qualifiers
FT   CDS_pept        107239..107475
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_01190"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_01190"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48366"
FT                   /db_xref="UniProtKB/TrEMBL:C1ASB7"
FT                   /protein_id="BAH48366.1"
FT                   /translation="MSSSPAEPDPGGHRASQPYLDHLLDPADATISTLRASRLLALANS
FT                   HDPHLIATTYGMSAEGVLAYFADRVDRTLLADL"
     atgtcatcgt caccagccga acccgatccg ggcggacacc gggcgtccca gccctacctc        60
     gaccacctcc tcgaccccgc cgacgccacg atctccacgc tgcgcgcctc ccgattgctg       120
     gccttggcca acagccacga tccccatctg attgccacca cctacggcat gagcgccgag       180
     ggcgtcctgg catacttcgc cgaccgtgtc gatcgcaccc tgctcgcgga cctgtga          237
//

If you have problems or comments...

PBIL Back to PBIL home page