(data stored in ACNUC7421 zone)

EMBL: AP011115.PE12

AP011115.PE12        Location/Qualifiers
FT   CDS_pept        11115..11645
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_00120"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_00120"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48259"
FT                   /db_xref="InterPro:IPR024775"
FT                   /db_xref="InterPro:IPR034660"
FT                   /db_xref="UniProtKB/TrEMBL:C1AS10"
FT                   /protein_id="BAH48259.1"
FT                   /translation="MPEKQPVDRAEIAADLDRARRTLHELLDHATAADFERRSNGTRWT
FT                   NEQLLFHMVFGYMVVRRLLVLVRVFSRLPDRVGRGFARALDATTPVFHQINYLGSCAAA
FT                   TVFDRRRMGRHCDRVIAKLQRSLAKESETNLRRSMAFPVRWDPFFDEVMTAEQVYRYPG
FT                   KHFDFHRDQLTLG"
     atgcccgaga aacagccggt ggaccgggcc gagatcgcgg ccgacctcga ccgggcccgg        60
     cggacactgc acgagctcct cgatcacgcc acggcggcgg atttcgagcg ccgctcgaac       120
     ggcacccgct ggaccaacga acagctgctg ttccacatgg tgttcggcta catggtggtg       180
     cgccgactgt tggtgctggt ccgggtcttc tcccggctgc ccgaccgggt cggccgcggc       240
     ttcgcgcggg cattggacgc gaccaccccg gtgttccacc agatcaacta cctcggctcg       300
     tgcgcggcgg ccaccgtgtt cgaccgccgc cggatgggcc ggcactgcga ccgcgtcatc       360
     gccaagctgc agcgctccct ggccaaggag tctgagacga acctgcggcg cagcatggcg       420
     ttcccggtgc ggtgggatcc gttcttcgac gaggtcatga ccgccgagca ggtgtatcga       480
     tatccgggta agcacttcga cttccaccgc gaccagctca ccctcggctg a                531
//

If you have problems or comments...

PBIL Back to PBIL home page