(data stored in ACNUC7421 zone)

EMBL: AP011115.PE126

AP011115.PE126       Location/Qualifiers
FT   CDS_pept        complement(114231..114497)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_01260"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_01260"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48373"
FT                   /db_xref="UniProtKB/TrEMBL:C1ASC4"
FT                   /protein_id="BAH48373.1"
FT                   /translation="MPRVQFRSVGLSDLDACLDWFAELTMTVDLDDADDVVVGSLDFTL
FT                   IRLGTEDPIALCLGQFDGDREIMACSMAINSPNRSRSSTRRWP"
     ttgccgcggg tgcagttccg gagcgtgggg ctcagcgatc tcgacgcgtg tctggattgg        60
     ttcgcggaat tgaccatgac ggtggatctc gacgacgccg acgatgtggt cgtcggttcc       120
     ctcgacttca cgctgatccg cctgggtacc gaggatccga tcgccctgtg cctgggccaa       180
     ttcgacggcg atcgcgagat tatggcctgt tcgatggcaa tcaactcgcc gaacaggtcg       240
     aggagcagta cgagacgctg gccgtga                                           267
//

If you have problems or comments...

PBIL Back to PBIL home page