(data stored in ACNUC7421 zone)

EMBL: AP011115.PE127

AP011115.PE127       Location/Qualifiers
FT   CDS_pept        complement(114923..115267)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_01270"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_01270"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48374"
FT                   /db_xref="UniProtKB/TrEMBL:C1ASC5"
FT                   /protein_id="BAH48374.1"
FT                   /translation="MVARTAGFVKQVISSTLYRPDGTVETTRDPAVWTLAHRGYSGSAR
FT                   LDVWAYRTKDDALRAGARLAMDCGMDEDARCRELFDAGRWTAVMERYEELSPDGHLLRV
FT                   QAAFLQLDDE"
     gtggtggcgc gcacagcagg cttcgtcaag caggtgatct cctcgacgct ctaccggccg        60
     gacgggacgg tcgaaacgac acgagacccg gcggtatgga cactcgctca ccgcggctac       120
     agtggatccg cgcgcctgga tgtgtgggcc taccgaacga aggacgacgc gctgcgggcc       180
     ggcgcgagac tggcgatgga ctgcggcatg gacgaggacg ctcggtgccg ggagctgttc       240
     gatgccggtc gctggacggc ggtgatggaa cgctacgagg aactcagccc ggacgggcat       300
     ctgctgcgcg tgcaggccgc gttcctgcaa ctcgacgacg aatga                       345
//

If you have problems or comments...

PBIL Back to PBIL home page