(data stored in ACNUC7421 zone)

EMBL: AP011115.PE128

AP011115.PE128       Location/Qualifiers
FT   CDS_pept        115545..115790
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_01280"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_01280"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48375"
FT                   /db_xref="UniProtKB/TrEMBL:C1ASC6"
FT                   /protein_id="BAH48375.1"
FT                   /translation="MGEEFLARAVAAALADGASWAEIGARLGVPTPHTTGAGGTPSDAD
FT                   WQNAIAEHENTHVTRRHPKPPGTQETTTPTDATGNH"
     ttgggcgagg aattcctcgc ccgggcagtg gccgccgccc tcgccgacgg cgcctcctgg        60
     gcagagatcg gcgcacgact cggagtaccg accccgcaca ccaccggcgc cggtggtaca       120
     ccttccgacg cggactggca gaacgcgatc gccgagcacg agaacacgca cgtcacccgg       180
     cgtcatccca aaccgcccgg cacgcaggag accacgacac ccacggacgc caccggaaac       240
     cactag                                                                  246
//

If you have problems or comments...

PBIL Back to PBIL home page