(data stored in ACNUC7421 zone)

EMBL: AP011115.PE129

AP011115.PE129       Location/Qualifiers
FT   CDS_pept        complement(115975..116223)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_01290"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_01290"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48376"
FT                   /db_xref="UniProtKB/TrEMBL:C1ASC7"
FT                   /protein_id="BAH48376.1"
FT                   /translation="MAHRSSTRRVHGPELKVGARVLVRRHAEADVIGEVVEDYGPLTES
FT                   GGRGHEWAPAHRWAVALDDGRLIFADTDEVTVDPGNR"
     atggcccaca gaagcagtac caggcgggta cacggccccg agttgaaggt cggcgcccgg        60
     gtgctcgtcc gccggcacgc cgaagccgac gtgatcgggg aggtcgtcga ggactacggg       120
     ccactgaccg aatccggtgg tcgtgggcac gagtgggcac cggcgcatcg gtgggcggtc       180
     gcgctcgacg acgggcggct gatcttcgcg gacaccgacg aggtaaccgt cgatcccggt       240
     aaccgctga                                                               249
//

If you have problems or comments...

PBIL Back to PBIL home page