(data stored in ACNUC7421 zone)

EMBL: AP011115.PE131

AP011115.PE131       Location/Qualifiers
FT   CDS_pept        117247..119745
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_01310"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_01310"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48378"
FT                   /db_xref="InterPro:IPR004027"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="UniProtKB/TrEMBL:C1ASC9"
FT                   /protein_id="BAH48378.1"
FT                   /translation="MRRYHRSVTDPTDPTAEAAMSLLREHGPLHPDEWARRLVAEGHGY
FT                   LADMEELTEYIGHPRLGYLADGRSAALDALLDGRVLTHRLTEMEISSGILDANPDLMPL
FT                   LPFDDDDPAAGGLRILFRDLDDDVFDERGALDADWPADAALLLEPDALTGLRPGDLVAL
FT                   TFTGGVLRLTAAENPPAPAPDLTAALTGLVTEDRPEPLDGVIWQLMADDPSLLTAPTTP
FT                   LGELITAAGYVCDGDDIAAAGFDFAAHRGKAHMATVAAAHHLTDDQTDAVLAFLALIGV
FT                   LERTPDDQRAAAVDAVAANFGDRFAGLAHPNAARAAFGEAYATAHAGTDTLRSAAAVLR
FT                   DRGPRRIAPTAHWLAGKAAELDGWTADAERHYERALAVDPNWDEALEALARFASDRGDA
FT                   VRAIGLLDRVEGAYREPMYDLLQSFLPVDRPDLGRNDRCWCGSGRKYKACHLGTAEHSL
FT                   EQRAGWLYQKAGSFAQGIEWRPLLLSLAQIRSVHNDDPFALYHALDDPLVADVVMFECG
FT                   AFARFVAERGVLLPADELLLAQQWSLTERSVHEVETVRPGEGLTLRDVRTGDRHEVTER
FT                   TASRQLRVGDFFCARVVPAGSTTQIFGGIEPIAPGQRGQLIELLDSNATDPEELVEFLS
FT                   ARFAPPRLITPDGHPMVACRAVFEIADTTGIRRKLSRRFGAADNDRWTWTEQNSVLGVL
FT                   TLTRSTDRWELEAEAMNEPRFESLIDAVRAADPGGRLREQTRTPAAELIAQTQDNGAHP
FT                   HQPVDPEDPEIAATLDEHIRRYEQQWLDEAIPALGGHTPRQCAADPTRRDELIRLLDSF
FT                   PQQDRPGAMSAHRLREALGL"
     gtgcgtcgat accatcgctc ggtgaccgat ccgacagatc ccaccgccga agccgccatg        60
     agcctcctcc gcgagcacgg gcccctgcac cccgacgaat gggcgcggcg gctggtcgcc       120
     gagggacacg gctacctcgc cgacatggag gaactcaccg agtacatcgg tcatccccgg       180
     ctcggctacc tggccgacgg tcgcagcgcg gccctcgacg cgctgctcga cggtcgggtg       240
     ctcacccacc ggctcaccga gatggaaatc tcctccggca tcctcgacgc caatccggac       300
     ctgatgccgc tgctgccctt cgacgatgac gacccggccg caggcggcct gcgcatcctc       360
     tttcgtgacc tcgatgacga cgtgttcgac gagcgcggcg ccctcgacgc ggactggccg       420
     gcggacgcgg cgctgctgct cgaaccggac gcgctcaccg gattgcggcc cggtgatctg       480
     gtcgcgctca ccttcacagg cggcgtcctg cggctcaccg ccgcggaaaa cccacccgca       540
     cccgcacccg atctcaccgc cgccctgacc ggcctggtga ccgaggatcg ccctgagccc       600
     ctcgacggtg tgatctggca gctgatggcc gacgacccgt ccctgctgac ggcgccgacc       660
     accccgctcg gtgagctgat caccgccgcc ggatacgtgt gcgacggcga cgacatcgcg       720
     gccgcggggt tcgacttcgc cgcccaccga gggaaggcgc acatggcgac ggtcgcggcg       780
     gcgcatcatc tcaccgacga tcagaccgac gcggtcctgg cgttcctggc cctgatcggg       840
     gtgctcgaac gcacccccga cgaccagcgc gcggccgccg tcgacgcggt cgcggcgaac       900
     ttcggtgacc ggttcgccgg gctcgcccac ccgaacgcgg cccgcgccgc gtttggcgag       960
     gcatacgcaa ccgcacacgc cggcaccgac accctacggt cggccgccgc ggtactccgc      1020
     gaccgcggcc cccgccggat cgccccgacc gcgcattggc tggcgggcaa ggcagccgaa      1080
     ctcgacggat ggaccgcaga cgccgagcgg cactacgagc gggccctggc cgtggacccg      1140
     aactgggacg aggcgctcga ggctttggcc cgcttcgcgt ccgatcgtgg tgacgcggtg      1200
     cgcgcgatcg gactgctcga ccgggtcgag ggtgcgtatc gcgaacccat gtacgacctg      1260
     ctccagtcgt ttcttcctgt cgaccggccg gacctggggc gcaacgatcg gtgctggtgc      1320
     ggatccgggc gcaaatacaa ggcgtgccac ctcggcacgg ccgaacactc actcgagcag      1380
     cgggctgggt ggctgtacca gaaggcgggc tcgttcgcgc agggcatcga gtggcgaccg      1440
     ctgctgctct cgctcgcaca aattcggtcc gtacacaacg acgacccgtt cgcgctgtat      1500
     cacgcgctcg acgacccgct ggtcgcggat gtggtgatgt tcgaatgcgg agccttcgcg      1560
     cggttcgtcg ccgagcgcgg cgtgctgctg cccgcggacg aactgctgct cgcacagcag      1620
     tggtcgctca ccgagcggtc ggtgcacgag gtcgagaccg tgcgtcccgg cgaggggctg      1680
     accctgcgcg acgtccgcac cggcgaccgc cacgaggtca ccgaacgcac cgccagcaga      1740
     cagcttcggg tcggcgactt cttctgcgcc cgcgtcgttc ccgccggatc cacgacgcag      1800
     atcttcggcg gcatcgaacc gatcgccccc gggcagcgtg gacagttgat cgagctgctc      1860
     gactcgaacg ccaccgaccc cgaagagctc gtcgagttcc tcagcgcccg attcgcgccg      1920
     ccacggctta tcacccccga cgggcatccg atggtggcat gccgggccgt gttcgagatc      1980
     gccgacacca ccggcatccg gcgcaagctc agccgccgct tcggcgccgc cgacaacgac      2040
     cggtggacct ggaccgaaca aaacagtgtg ctcggcgtgc tcaccctcac ccggagcacc      2100
     gaccgctggg agctcgaggc cgaggcgatg aacgagccac gcttcgagtc cctgatcgac      2160
     gccgtgcgcg ccgccgaccc cggcgggaga ctgcgcgagc agacccgcac gccggcagcg      2220
     gaactgatcg cacaaaccca ggacaacggc gctcacccac accaacccgt cgaccccgag      2280
     gaccccgaga tcgcggcgac gctcgacgag cacatccgcc gatacgagca gcagtggctc      2340
     gacgaggcga tccccgccct cggcggtcac accccgcgcc agtgcgcggc cgaccccacc      2400
     cgccgcgacg agctgatccg gctgctcgac tccttccctc agcaggatcg gccgggggcg      2460
     atgagcgcgc accggctgcg ggaagcgttg gggctctaa                             2499
//

If you have problems or comments...

PBIL Back to PBIL home page