(data stored in ACNUC7421 zone)

EMBL: AP011115.PE133

AP011115.PE133       Location/Qualifiers
FT   CDS_pept        123061..123699
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_01330"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_01330"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48380"
FT                   /db_xref="UniProtKB/TrEMBL:C1ASD1"
FT                   /protein_id="BAH48380.1"
FT                   /translation="MRPSSSPMIGEVVAAVRAFIDGIDEITEVDQVFLDNATAVWQIGR
FT                   AVPLPGIGGRNRGEPDFLPTPVTRMFLWHITHYQPGAAEQHERAAHISRHRTSAGPAAK
FT                   YQLDWFRIDTPGSRGRGRLQRDDVLLQVTADNEWLYSPAVVDSDPNAIPHTRTAVAYHL
FT                   RTRVDLEPIAVTDAEVLLADAGHPGPRLRTDHRIVSASLRAALLRLWNL"
     atgaggccgt cgtcgtcacc gatgatcggc gaggtcgtgg ccgccgtccg ggccttcatc        60
     gacggtatcg acgagatcac cgaggtcgac caggtgttcc tcgacaacgc caccgccgtc       120
     tggcagatcg gccgggccgt acccctgccc gggatcggcg gccgcaaccg cggcgaaccc       180
     gacttcctcc ccaccccggt aacccggatg ttcctgtggc acatcaccca ttaccagccc       240
     ggcgcggcgg aacaacacga gcgtgcagcc cacatcagcc gccaccgtac gtccgcgggt       300
     ccggcggcga agtaccagct cgactggttc cgcatcgaca cccccggcag ccgcggccgt       360
     ggccggctcc agcgggacga cgtcctgctc caggtcaccg ccgacaacga atggctctac       420
     tcgccggcgg tcgtggactc cgacccgaac gcgatccccc acactcgcac agcggtggcg       480
     taccacctgc gtacccgagt cgacctggag ccgatcgcgg tgaccgatgc ggaagtactg       540
     ctcgccgatg ccgggcaccc gggtccccgg ctgcgcaccg accaccgcat cgtctccgcc       600
     agcctgcggg ccgcgctgct ccgactctgg aacctgtga                              639
//

If you have problems or comments...

PBIL Back to PBIL home page