(data stored in ACNUC7421 zone)

EMBL: AP011115.PE134

AP011115.PE134       Location/Qualifiers
FT   CDS_pept        124043..124543
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_01340"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_01340"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48381"
FT                   /db_xref="InterPro:IPR005114"
FT                   /db_xref="UniProtKB/TrEMBL:C1ASD2"
FT                   /protein_id="BAH48381.1"
FT                   /translation="MISMRARPPAASPLQLYAEFRRRHPALVMPANYVTECGFRLGRWQ
FT                   NRQRVARMLGTLPPQRITQLDAIGFVWTDDSAPLPAVPPAEGKRRRMLTEIAAYREEHG
FT                   DALVPANYVTADGEQVGQWLYRAVKKWRANALPDNERRPLAVLGVSPGPRPRGPRLSAH
FT                   PMR"
     gtgatctcga tgcgagcacg gccgccggcg gcctcacctc tgcagctcta cgccgagttt        60
     cgccgccgtc accccgcact cgtgatgccc gccaactacg tcaccgagtg cggcttccga       120
     ctgggacgtt ggcagaaccg tcagcgggtt gcccgcatgc tcggcaccct gccgccgcaa       180
     cgcattacgc aactcgatgc gatcggcttc gtgtggaccg atgacagcgc gccgctccct       240
     gccgtgccac cggccgaggg caagcggcga cggatgctca ccgaaatcgc cgcctaccgc       300
     gaagaacacg gcgacgcact cgtccccgca aactatgtca ccgccgacgg tgaacaggtg       360
     ggccagtggc tctaccgggc agtgaaaaag tggcgagcca acgcactgcc ggacaacgag       420
     cggcgccccc tagcagtcct cggggtgtcc cccgggccgc gcccacgggg accacgactc       480
     tcagcgcacc cgatgcgata g                                                 501
//

If you have problems or comments...

PBIL Back to PBIL home page