(data stored in ACNUC7421 zone)

EMBL: AP011115.PE135

AP011115.PE135       Location/Qualifiers
FT   CDS_pept        125346..125726
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_01350"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_01350"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48382"
FT                   /db_xref="InterPro:IPR032710"
FT                   /db_xref="InterPro:IPR037401"
FT                   /db_xref="UniProtKB/TrEMBL:C1ASD3"
FT                   /protein_id="BAH48382.1"
FT                   /translation="MRGTADVREFLDHGWRAFPDLTFELAAGPTHNERRPPRRLLVKTT
FT                   ATHQGPLDPPGIPATGTHIEFDGVDIHEYRDGKIATADHHQHDDIALQEGLLPAPGSKA
FT                   ERVMTGLQKLRSRLTRSRTSST"
     atgcgcggca cagccgacgt acgagagttc ctcgaccacg gctggcgcgc gttccccgac        60
     ctgaccttcg aactcgccgc cggccccaca cacaacgaac gacggccccc gcgccgccta       120
     ctggtgaaga cgaccgccac ccaccaaggc ccgctcgacc cacccggtat ccccgccacc       180
     ggcacacaca tcgaattcga cggcgtcgac atccacgaat accgcgacgg caaaatcgcc       240
     actgcggatc atcaccaaca tgacgacatc gccttgcagg agggcttgct ccccgcaccc       300
     gggagcaagg ccgaaagagt catgacagga ctccaaaaac tccgatcccg cctcacccgc       360
     tcccgaacgt cgtcgacctg a                                                 381
//

If you have problems or comments...

PBIL Back to PBIL home page