(data stored in ACNUC7421 zone)

EMBL: AP011115.PE137

AP011115.PE137       Location/Qualifiers
FT   CDS_pept        126384..126932
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_01370"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_01370"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48384"
FT                   /db_xref="UniProtKB/TrEMBL:C1ASD5"
FT                   /protein_id="BAH48384.1"
FT                   /translation="MRITDSARKHHISNTDITHAFENAIRYAEYEDDGEERLLIIGTDT
FT                   AGRLLEPVAAPAGEPNRRVRAAIAAAASETTREGGRQPHCHTPHPLTPRRRRPGTEAGR
FT                   LLRGGTKIRGAAGGAGAGSLRHNGLRARHGQRQGFSTAWGPWQRRGRPRYLARPTIARC
FT                   GAVRGLEPATSTPDLRLAD"
     gtgcggatca ccgactcggc acgtaaacac cacatcagca acaccgacat cacccacgcg        60
     ttcgagaacg cgatccgcta cgccgagtac gaggacgacg gcgaggaacg gctcctcatc       120
     atcggcaccg acaccgcagg gcgactcctc gaaccagtcg ccgcgcccgc cggcgagccg       180
     aaccggaggg tcagggccgc gatcgccgca gcagcgtccg aaaccacccg cgagggtggt       240
     cggcagccgc actgtcatac cccgcaccct ctcaccccca ggcgccggcg accgggaacc       300
     gaggcagggc ggttgttacg cggcgggacc aaaatcagag gcgccgccgg cggcgcgggc       360
     gccggcagtc tccggcacaa cggacttcga gctcggcatg gtcaacggca aggtttcagc       420
     actgcgtggg gtccttggca gagaagggga cgtcctcgat acctagcacg gccaaccatc       480
     gctcgttgcg gcgcggttcg aggtctggag ccggccacct cgacccccga cctccgcctc       540
     gccgattga                                                               549
//

If you have problems or comments...

PBIL Back to PBIL home page