(data stored in ACNUC7421 zone)

EMBL: AP011115.PE138

AP011115.PE138       Location/Qualifiers
FT   CDS_pept        complement(126965..127318)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_01380"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_01380"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48385"
FT                   /db_xref="UniProtKB/TrEMBL:C1ASD6"
FT                   /protein_id="BAH48385.1"
FT                   /translation="MSPKRGERVAPPAAGELWDLRFATSDAAKGWDELCRQAPANTLVA
FT                   YEELRRRAVGQESTTRHHRLKGRLATGVHNGVEMEQWQYEVTAGGRVWYVVDVEHRTLW
FT                   LKYAGTAHPKQTE"
     gtgagcccga agcggggcga gcgggtcgcg ccgccggccg ctggggagct gtgggacctg        60
     cggttcgcga cgagtgatgc ggcgaagggg tgggacgagc tgtgccggca ggcgccggcg       120
     aacacgctgg tggcgtacga ggaactacgt cgccgcgcgg tcgggcagga gtcgacgacg       180
     cgtcatcacc ggttgaaggg caggctcgcg accggggtgc acaacggggt ggagatggag       240
     cagtggcagt acgaggtcac cgccggcggg cgggtctggt acgtggtgga cgtcgagcac       300
     cgcacgttgt ggctgaagta tgcgggcacg gcgcacccca aacagaccga atga             354
//

If you have problems or comments...

PBIL Back to PBIL home page