(data stored in ACNUC7421 zone)

EMBL: AP011115.PE139

AP011115.PE139       Location/Qualifiers
FT   CDS_pept        complement(127315..127782)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_01390"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_01390"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48386"
FT                   /db_xref="UniProtKB/TrEMBL:C1ASD7"
FT                   /protein_id="BAH48386.1"
FT                   /translation="MSVGEVPFSDIQNKGKATLAEWQRSGARPLRVTRRDDEDLVLMTA
FT                   VRADQEREVLAAATAMVEALLHSDDRVLVRKVVAAAFPWVSYLSGEELADFVDELIASL
FT                   RAGSSLDNPAPPARTIETWRHTAEVYADPDLARILSAPSGGDFGVVPVPEL"
     atgtctgtgg gtgaggtgcc gttctcggat attcagaaca aggggaaggc gacgttggcg        60
     gagtggcagc ggtcgggtgc gcggccgttg cgggtgacgc gccgcgacga tgaggatttg       120
     gtgttgatga cggcggtgcg ggcggatcag gagcgggagg tgctggcggc ggcgacggcg       180
     atggtcgagg ccctgttgca ctctgatgat cgtgttttgg tccgcaaggt ggtggcggcg       240
     gcgtttccgt gggtgagcta cctctcgggt gaggagctcg ccgacttcgt cgacgagctg       300
     atcgcgtcgc tgcgggcggg gtcgtcgctg gataatccgg ctccgcctgc tcgcacgatc       360
     gagacgtggc ggcacacggc ggaggtgtat gccgatccgg atcttgcccg gatcctgtcg       420
     gcgccgtccg gcggtgactt cggggtcgtg ccggtgccgg agctgtga                    468
//

If you have problems or comments...

PBIL Back to PBIL home page