(data stored in ACNUC7421 zone)

EMBL: AP011115.PE140

AP011115.PE140       Location/Qualifiers
FT   CDS_pept        complement(127811..128017)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_01400"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_01400"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48387"
FT                   /db_xref="UniProtKB/TrEMBL:C1ASD8"
FT                   /protein_id="BAH48387.1"
FT                   /translation="MSQGVSFSLSTRFVQNDSVMESELYERCLSLELLPILLLCAGGGG
FT                   VGFSFVSTVGGASSVPERSPSPC"
     gtgtcgcagg gcgtctcgtt ctcgctgagc acgcggttcg tgcagaacga ctcggtgatg        60
     gagagcgaac tgtacgagcg ttgcctgtcg ctggagttgc tcccgattct tctgctatgt       120
     gccggcggtg gtggtgtggg tttcagcttc gtcagcacgg ttggcggcgc ctcgtccgta       180
     ccggagcgct ctccctcacc ttgctga                                           207
//

If you have problems or comments...

PBIL Back to PBIL home page