(data stored in ACNUC7421 zone)

EMBL: AP011115.PE141

AP011115.PE141       Location/Qualifiers
FT   CDS_pept        complement(128075..128374)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_01410"
FT                   /product="hypothetical membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_01410"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48388"
FT                   /db_xref="GOA:C1ASD9"
FT                   /db_xref="InterPro:IPR022703"
FT                   /db_xref="UniProtKB/TrEMBL:C1ASD9"
FT                   /protein_id="BAH48388.1"
FT                   /translation="MFVMLGLPSSGGTIPLEATPSLYRWLGGFEPMHQIYRGVRAIIFF
FT                   GASGAAGLIHAVWMTFAGLVIGLVVGAVITRFYDRKGLHRRLEAQAPVPVEARS"
     ttgttcgtga tgctggggct gccgtcgtcg ggcggcacca tcccgctcga ggcgactccg        60
     tcgctgtacc ggtggctcgg cgggttcgag ccgatgcatc agatctaccg cggcgtccgc       120
     gcgatcatct tcttcggggc gagcggcgcc gccggcctca tccacgcggt gtggatgacg       180
     ttcgccggcc tggttatcgg gctcgttgtc ggggccgtca tcacccggtt ctacgaccga       240
     aagggtctgc accgacgcct cgaagcgcag gcaccggtac ctgtggaagc tcggagctga       300
//

If you have problems or comments...

PBIL Back to PBIL home page