(data stored in ACNUC7421 zone)

EMBL: AP011115.PE142

AP011115.PE142       Location/Qualifiers
FT   CDS_pept        complement(128365..129435)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_01420"
FT                   /product="hypothetical membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_01420"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48389"
FT                   /db_xref="GOA:C1ASE0"
FT                   /db_xref="InterPro:IPR022703"
FT                   /db_xref="UniProtKB/TrEMBL:C1ASE0"
FT                   /protein_id="BAH48389.1"
FT                   /translation="MARTGGSGTDDPVVNRSAWSVLRTPRLVMAPVVLVCIVMSLLAVL
FT                   YMGAMLDPTKHLHHFPIALVDQDEGDTVPGSDPPVQRKLGDQIAAGLIDGVDPEKIQFR
FT                   RMGIVEARSLLDDGKIYGAIGIPSDFTKRTFVLAQASVVPGDVDRPVITVYTNPRAGTI
FT                   SANIVRAVGATALDEANRALGEQLTAQVNEQLAAGGGGTQLSGASRLVLADPIDVRTVA
FT                   HNPLPFGTGFGLAAFYYALLLVLAGFTGANLVNALVDGMLGFTPTEVGPLYLYRAAVPI
FT                   SRFHTLLVKWAIVVALGMIVSGLYLGIGSALGLPVTDPLALWGYGAFAIAAVGITAVSV
FT                   VAAIGNLGLLAICSCS"
     atggcgcgta cgggtgggag tgggacggac gatccggtcg tgaaccggag cgcgtggagt        60
     gtgctgcgga cgccacgcct ggtgatggcc ccggtcgttt tggtctgcat cgtgatgtcg       120
     ctgctggctg ttctgtacat gggcgccatg ctcgatccca ccaagcacct ccatcacttc       180
     ccgatcgccc tcgtcgacca ggacgagggc gacaccgtgc ccggctcgga tccaccggtg       240
     cagcggaagc tcggtgacca gatcgcggcc gggctgatcg acggcgtcga tccggagaag       300
     atccagttcc gacggatggg catcgtcgag gcgcggtcgc tgctcgacga cgggaagatc       360
     tacggtgcca tcggcatccc gagcgacttc accaaacgta ccttcgtcct cgcgcaggcg       420
     agtgtggttc ccggcgacgt ggatcgtccg gtgattaccg tctacaccaa tccccgggcc       480
     ggcacgatca gcgccaacat cgtcagggcc gtcggtgcga cggccctgga cgaggccaac       540
     cgggcattgg gcgaacagct caccgcacag gtgaacgagc agttggcggc gggtggcggc       600
     gggacgcagc tgtcgggggc gagccgactc gtactcgccg acccgatcga cgttcggacg       660
     gtcgcgcaca acccgttacc cttcggcacg ggtttcggcc tggccgcgtt ctattacgct       720
     ctcctgctcg tgttggcggg gttcacgggg gcgaacctcg tcaacgcgct cgtcgacggc       780
     atgctcggct tcacccccac cgaggtcggt ccgctgtatc tgtatcgagc ggccgtgccg       840
     atctcccgct tccacaccct gctggtcaag tgggcaatcg tggtcgctct cggcatgatc       900
     gtctccgggc tgtacctcgg gatcggttcg gcgctgggac tgcccgtcac cgacccgctg       960
     gcactgtggg gatacggcgc gttcgcgatc gccgccgtcg ggatcacggc cgtgtccgtc      1020
     gttgccgcga tcggcaacct cggactgctc gcaatctgct cttgttcgtg a               1071
//

If you have problems or comments...

PBIL Back to PBIL home page