(data stored in ACNUC7421 zone)

EMBL: AP011115.PE143

AP011115.PE143       Location/Qualifiers
FT   CDS_pept        129716..129982
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_01430"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_01430"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48390"
FT                   /db_xref="UniProtKB/TrEMBL:C1ASE1"
FT                   /protein_id="BAH48390.1"
FT                   /translation="MRYGQCGMGGAVWAVQTISMELGTLVVDPGTGHDTTITVVQVATD
FT                   RDTFTRLDLSRVEARATLDHLRAGVSKNPHDLVPVAHSRGVRG"
     gtgcggtatg ggcagtgcgg tatgggcggt gcggtatggg cggtgcagac catctcgatg        60
     gaactcggca ccctcgtggt cgaccccggc accgggcacg acaccaccat caccgtggtg       120
     caggtggcca ccgaccggga caccttcacc cgcctcgacc tctcccgggt cgaggcccgc       180
     gccaccctcg accatctgcg ggccggggtg tcgaagaatc cgcacgacct ggtgccggtc       240
     gcccactccc gcggcgtccg cggctaa                                           267
//

If you have problems or comments...

PBIL Back to PBIL home page