(data stored in ACNUC7421 zone)

EMBL: AP011115.PE146

AP011115.PE146       Location/Qualifiers
FT   CDS_pept        complement(131307..131858)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_01460"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_01460"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48393"
FT                   /db_xref="InterPro:IPR002716"
FT                   /db_xref="UniProtKB/TrEMBL:C1ASE4"
FT                   /protein_id="BAH48393.1"
FT                   /translation="MTFTVLYDANVLYPNVLRDVLIRLAQTGLVHARWTDRILNETFEN
FT                   LAEDRPDIPAATLTKLRELMNRAVPDCLVTGYEKLIPALTLPDADDRHVLAAAIRAGAQ
FT                   VIVTANLRDFPDAELAQFGIEAKHPDEFVMDLFHLDGVRVHQAVSATAAAWRNPPGTPA
FT                   DVCDRLAAAGLPISAAALRR"
     gtgaccttca ccgtgctcta cgacgcgaat gtgctgtacc cgaatgtgtt acgagatgtg        60
     ctgatccggc tcgcgcagac cggcctggtg cacgcgcggt ggacggatcg catcctgaac       120
     gagacgttcg agaacttggc cgaagatcgc ccggacatcc cggcagcgac gttgacgaag       180
     ctacgggagc tgatgaacag ggcggtaccg gactgcctgg tcaccggcta cgagaaactc       240
     atccccgcac tcacgctgcc ggatgcggac gaccgacatg tgctcgccgc ggcgatccgc       300
     gccggcgccc aggtcatcgt caccgccaat ctgcgggact tccccgacgc ggagctggcg       360
     cagttcggca tcgaggccaa acatccggac gagttcgtga tggatctgtt ccacctcgac       420
     ggggtacggg tccatcaagc ggtcagcgcg acggccgcgg cctggcgcaa tccacccggg       480
     accccggccg atgtgtgtga ccgccttgcg gcggcgggcc ttcccatctc cgcggccgcg       540
     ctccgccgct ga                                                           552
//

If you have problems or comments...

PBIL Back to PBIL home page