(data stored in ACNUC7421 zone)

EMBL: AP011115.PE149

AP011115.PE149       Location/Qualifiers
FT   CDS_pept        complement(133005..133856)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_01490"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_01490"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48396"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="InterPro:IPR034405"
FT                   /db_xref="UniProtKB/TrEMBL:C1ASE7"
FT                   /protein_id="BAH48396.1"
FT                   /translation="MDNPRHWVGHLRVLSGIQDRIGGFTEFVPLPFVHQSAPLYLAGAS
FT                   RPGPTNRDNRAVHALARIMLHGRIPNIQTSWVKLGVTGTQVMLQGGANDLGGTLMEETI
FT                   SRMAGSEHGSEKTVEELRAIAEGIGRPARETHHHTRPPAPPPRAVMSTIGVDGYAVVVP
FT                   IRSLRMAKSRLRTSDTMRSQLALAFFLDTITALERKHRGGADRGGLRRRHHPGVGAGAL
FT                   RRPDGRRNGPPRRNQSRHRKAPKDKPFRAGGRRPPGTALCDRWRVRHASRLCTRTPAGL
FT                   PG"
     gtggacaatc cgaggcattg ggtggggcat ctgcgggtgc tgtccgggat tcaggatcgg        60
     atcggggggt tcacggagtt cgtgccgttg ccgttcgtgc atcagagtgc gccgttgtat       120
     ctggcggggg cgtcgcggcc gggtccgacg aatcgggaca accgggcggt tcatgcgttg       180
     gcgcggatca tgttgcacgg gcggatcccg aacattcaga ccagttgggt caagttgggg       240
     gtgacgggta cgcaggtgat gttgcagggc ggggcgaacg acctcggggg cacgttgatg       300
     gaggagacca tctcgaggat ggccgggtcc gagcacgggt cggagaagac cgtcgaagag       360
     ttgcgggcca tcgccgaggg catcggccgc cctgcacgcg aaacgcacca ccacacacgc       420
     ccgccagcac cccctccccg cgctgttatg agcacgatcg gggtcgacgg ctatgcggtg       480
     gtggtgccga tcagatccct gaggatggcg aagagtcgac ttcggacatc cgacacgatg       540
     cgttcgcaac tcgcgttggc gttcttcctc gacacgatca ccgccctcga acgcaagcac       600
     cgaggtggag cggatcgtgg tggtctccgg cgacgccacc atccaggcgt tggcgcgggg       660
     gcgctgcgac gtcctgacgg acgacgaaac gggcctcccc gacgcaatca atcgcggcat       720
     cgaaaggctc cgaaggataa gccattccgg gccggtggcc gtcgtcctcc cggaactgcc       780
     ctatgcgacc gctggcgcgt tcgacatgct tctcgcctct gcacgcgaac acctgcgggc       840
     ctacctggct ga                                                           852
//

If you have problems or comments...

PBIL Back to PBIL home page