(data stored in ACNUC7421 zone)

EMBL: AP011115.PE150

AP011115.PE150       Location/Qualifiers
FT   CDS_pept        complement(134019..134603)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_01500"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_01500"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48397"
FT                   /db_xref="UniProtKB/TrEMBL:C1ASE8"
FT                   /protein_id="BAH48397.1"
FT                   /translation="MRTRGGGRNGFCTDVVADVADRFVVSAGGIPRASDARGWAGGVHP
FT                   ARGRRRRGGAGDVRGRCRRRAGGIVVPQAGPPVADLTGPVGLGHRRPRRSRPSRPPGRA
FT                   APARGHRGAADPGVPAACDPAGSVPAAVGDAPDRGPGRRPVRGLHQDPPRPRRRRDGDD
FT                   PAATQHDRGSVPPRHVRPWQPTRAENESSRV"
     gtgcgcaccc ggggaggggg gaggaatggg ttctgcaccg atgttgttgc cgatgtcgcc        60
     gaccgattcg ttgtttctgc tgggggaatc ccgcgagcat ccgatgcacg tgggtgggct       120
     ggcggtgttc accccgcccg agggcgccga cgccgcggtg gtgcgggaga tgttcgaggc       180
     cgctgtcgac gacgagcagg tggcatcgtt gttccgcagg cgggcccgcc ggtcgctgac       240
     ctcactgggc cagtggggct gggacaccgc cgaccacgtc gatctcggcc atcacgtccg       300
     ccgggacgcg ctgccccggc ccgggggcac cggggagctg ctgaccctgg tgtcccggct       360
     gcatgcgacc ctgctggatc ggtcccggcc gctgtgggag atgcacctga tcgagggcct       420
     ggccgacggc cggtacgcgg tttacaccaa gatccaccac gccctcgccg acggcgcgac       480
     ggcgatgacc ctgctgcaac gcagcatgac cgaggatccg taccgccgcg gcatgtccgc       540
     ccctggcaac cgacccgcgc cgagaatgaa tcgtcccgag tttga                       585
//

If you have problems or comments...

PBIL Back to PBIL home page