(data stored in ACNUC7421 zone)

EMBL: AP011115.PE158

AP011115.PE158       Location/Qualifiers
FT   CDS_pept        complement(140844..141416)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_01580"
FT                   /product="hypothetical membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_01580"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48405"
FT                   /db_xref="GOA:C1ASF6"
FT                   /db_xref="InterPro:IPR025492"
FT                   /db_xref="UniProtKB/TrEMBL:C1ASF6"
FT                   /protein_id="BAH48405.1"
FT                   /translation="MISTQPAQRGSRSPPRFRRRPCWWGRCSWWSGCSGSSPGVTTDYD
FT                   TLTFAGHHTEAALLGIFQVSVLHNIVHLLFGVAGIAAARTAGAAKGFLVGGGLIYLVLW
FT                   IYGLVIDQDGSAYFVPVNTADNWLHLVLGAGMVVLGLLLPRLRTTAPRLIPPPLPGRGA
FT                   VALRLSVAGPGGAGVESGGLLGLVVGA"
     gtgatatcaa cgcaacctgc ccagcgtggt tctcgttcgc caccccggtt caggcggcgt        60
     ccctgctggt gggggcggtg ttcctggtgg tcggggtgct cgggttcatc cccgggggtg       120
     accaccgact acgacacgct caccttcgcc ggccatcaca ccgaggccgc actgctggga       180
     atattccagg tgtccgtcct gcacaacatc gtgcatctgc tgttcggggt ggccgggatc       240
     gcggcggcgc gcacggccgg cgccgcgaaa ggcttcctcg tcggcggcgg gctcatctat       300
     ctggtgctgt ggatctacgg tctggtcatc gatcaggacg gcagcgcgta ctttgtgccg       360
     gtcaacaccg ccgacaactg gctgcacctc gtcctcggtg ccgggatggt tgtcctcggg       420
     ttgctgttgc cgcggctgcg caccaccgca ccgagattga tcccaccgcc tctgcccggc       480
     cgcggtgccg tcgccctgcg gctatcggtg gccgggccag gcggcgcggg ggtcgaatcc       540
     ggtggccttc tcggccttgt cgtaggcgcg tag                                    573
//

If you have problems or comments...

PBIL Back to PBIL home page