(data stored in ACNUC7421 zone)

EMBL: AP011115.PE159

AP011115.PE159       Location/Qualifiers
FT   CDS_pept        complement(141662..142153)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_01590"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_01590"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48406"
FT                   /db_xref="UniProtKB/TrEMBL:C1ASF7"
FT                   /protein_id="BAH48406.1"
FT                   /translation="MGSDLGGRFGPDAEVAGHLLALVSEHRYPALGRELSSLMAPPDPA
FT                   AGGGSCYGGVLAWLTGAIADVAVARLGPAAQDESFILEVRTAAGQLVDARKLPPRQARV
FT                   ARSVLALLAGDRAAARVHLGAAEREPDSQVRVTTLIEALTWLNALLDAPTPALPDPPPQ
FT                   "
     atggggtccg atctcggcgg gcgcttcggc ccggatgcgg aggtggccgg ccacctgctc        60
     gcgctggtct ccgaacaccg gtacccggcg ctgggccggg agctgtcctc gctgatggcg       120
     ccgccggatc ccgcggccgg cggcgggagt tgctacggcg gggtgctggc ctggctgacc       180
     ggcgcaatcg ccgacgtggc cgtcgcccgg ctcgggcctg ccgcgcagga tgaatcgttc       240
     atcctcgagg tccgcaccgc ggccgggcag ctcgtcgacg cccggaagct gccgccgcgg       300
     caggcccggg tggcgcggtc ggtgctggcc ctgctggccg gcgaccgagc cgccgcccgg       360
     gtgcacctgg gtgccgccga acgtgaaccc gactcgcagg tgcgggtcac caccctgatc       420
     gaggcactga cctggctcaa cgccctcctc gacgccccca ccccggcgct gcccgaccca       480
     ccaccccaat ag                                                           492
//

If you have problems or comments...

PBIL Back to PBIL home page