(data stored in ACNUC7421 zone)

EMBL: AP011115.PE162

AP011115.PE162       Location/Qualifiers
FT   CDS_pept        complement(143425..143712)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_01620"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_01620"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48409"
FT                   /db_xref="UniProtKB/TrEMBL:C1ASG0"
FT                   /protein_id="BAH48409.1"
FT                   /translation="MTTSPHITTDHAEIRRWIQAHRGGPARDGTGSLRIDFLGVATGLE
FT                   HLSWKQWFTAFEDQNLALCYPQPHVHGGTSAWCELAPRTRTATGAAGSVR"
     atgaccacat caccgcatat caccaccgat cacgccgaga tccgtcgatg gatccaggcc        60
     catcgcggcg gaccggcacg cgacggcaca ggcagtctcc ggatcgactt cctcggtgtc       120
     gccaccggac tcgagcatct gtcctggaag cagtggttca ccgccttcga ggaccagaac       180
     ctggccctgt gctatccgca gccgcatgtt cacggcggca ccagcgcctg gtgcgaactg       240
     gcgccgcgca cccgaaccgc caccggcgca gccggttcgg tccgatga                    288
//

If you have problems or comments...

PBIL Back to PBIL home page