(data stored in ACNUC7421 zone)

EMBL: AP011115.PE166

AP011115.PE166       Location/Qualifiers
FT   CDS_pept        145410..145718
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_01660"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_01660"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48413"
FT                   /db_xref="UniProtKB/TrEMBL:C1ASG4"
FT                   /protein_id="BAH48413.1"
FT                   /translation="MTSTNPVAEVNATDTRERTERETMWPWHELDYALLVADSDRILAD
FT                   ALTPQAVVLLHRVATAPAGRARPSPPTPVGWTALPPPLPEIRATQRSPPRPEKPGKV"
     atgacatcga caaacccggt tgccgaggtg aacgccaccg acaccaggga gcgcaccgaa        60
     cgcgagacga tgtggccgtg gcacgagctc gactacgcac tgctcgtggc cgattcggac       120
     cgcatcctcg ccgacgcgct cacgccgcag gccgtggtcc tgctccaccg ggtggccacc       180
     gcaccggccg gccgggcgcg tccatctcct cccactccgg tggggtggac ggcgcttccc       240
     ccgccgctgc ccgagatccg cgccacgcag cgctcacctc cgaggccgga gaagccgggc       300
     aaggtctga                                                               309
//

If you have problems or comments...

PBIL Back to PBIL home page