(data stored in ACNUC7421 zone)

EMBL: AP011115.PE167

AP011115.PE167       Location/Qualifiers
FT   CDS_pept        146105..146512
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_01670"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_01670"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48414"
FT                   /db_xref="InterPro:IPR001623"
FT                   /db_xref="InterPro:IPR036869"
FT                   /db_xref="UniProtKB/TrEMBL:C1ASG5"
FT                   /protein_id="BAH48414.1"
FT                   /translation="MATERDPYRVLGLSPSASQADIASAYRRLLRRHHPDTRTRHPADP
FT                   AADEYLQQVMTAYALLRDPDHRAAHNQAEADRTEADRVDAEAIVPEPRGRRRGRAPWAA
FT                   APPLIRVVVADAPPPHPPATGLWVGPVRRHR"
     atggccaccg aacgcgatcc ctatcgggtg ctgggcctgt ccccgtcggc gtcccaggcc        60
     gacatcgcca gcgcctaccg gcggctgctg cgccggcacc accccgacac ccgcacccgt       120
     caccccgccg acccggcggc ggacgagtac ctccagcagg tcatgaccgc ctacgccctg       180
     ctccgcgacc ccgaccaccg cgccgcccac aaccaggcag aagcagaccg gacagaagca       240
     gaccgggtgg acgccgaggc gatagtgccc gaacctcggg gacgacggcg cgggcgagca       300
     ccgtgggccg cggccccacc attgattcgc gtcgtggtgg ccgacgcccc gccgccccat       360
     ccacccgcca ccggattgtg ggtcggaccg gtgcgacggc accgctga                    408
//

If you have problems or comments...

PBIL Back to PBIL home page