(data stored in ACNUC7421 zone)

EMBL: AP011115.PE168

AP011115.PE168       Location/Qualifiers
FT   CDS_pept        complement(146930..147970)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_01680"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_01680"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48415"
FT                   /db_xref="GOA:C1ASG6"
FT                   /db_xref="InterPro:IPR011251"
FT                   /db_xref="InterPro:IPR036661"
FT                   /db_xref="UniProtKB/TrEMBL:C1ASG6"
FT                   /protein_id="BAH48415.1"
FT                   /translation="MSTPTTGNVASGVSATRRGLGICVTPLETRRDVILHVARRAEDLG
FT                   YDGFFLAEGWSQDAAVLLTEIATKTERITIGTGVLSVWGRTAGTLAMLATSLDQVSHGR
FT                   FVLGLGASSPQLVEGLHDQSFTAPVAKLRAVTAQVRRLLDGERVSPTTTHDHRSLRLGV
FT                   AARTGLPIYLAGLGNKSIQLAGELADGWMPFLVPRSWLPHGIDLLQQAGARSGHTTRPL
FT                   VCPAVPTAVAADQAKAHEIASWWIAFYLTSMGSLYRRSLSERGYHHQVEAVLASNPTHD
FT                   TTDVPAAAHALLDELTVWGTPDTAHDHLQRWYTAGAETPILTLTLPPHRTTAELDYMLE
FT                   TMRPHP"
     atgagcaccc ccacaaccgg caacgtcgcc tccggcgtca gcgctacccg gcgcggcctc        60
     ggtatctgcg tgaccccact cgaaacgcgc cgtgacgtga tactgcatgt cgcccgccgc       120
     gccgaagatc tcggctatga cgggtttttc ctcgccgagg ggtggagtca ggatgccgcc       180
     gtcctgctca ccgaaatcgc caccaagacc gaacgaatca ccatcggtac cggtgtgctc       240
     agcgtctggg gccgcaccgc cggcaccctc gcgatgctcg ccaccagcct cgaccaggtc       300
     tcacacggcc gtttcgtcct cggcttgggt gcaagcagcc cacagctcgt cgaaggactg       360
     cacgaccaat cgttcaccgc gccggtggcc aagctgcgcg cggtcaccgc acaggtccgt       420
     cgactgctcg acggcgagcg agtcagcccg acaacgaccc acgaccaccg gtccctgcgg       480
     ctgggtgtcg ccgcgcgcac cggcctgccg atctacctcg ccggactcgg aaacaaatcc       540
     atccaactcg ccggtgaact ggcggacggc tggatgccct tcctggtccc gcggtcgtgg       600
     ctgccccacg gaatcgacct gctccagcag gcgggcgccc gatccggcca caccacacgc       660
     cccttggtgt gtccggccgt ccccaccgcc gtcgcggccg atcaggcaaa ggcccacgag       720
     atcgcgtcct ggtggatcgc gttctacctc accagcatgg gctcgctcta ccgccgctcg       780
     ctgagcgaac ggggatacca ccaccaggtc gaggccgtgc tcgccagcaa cccgacccac       840
     gacaccaccg acgtgccagc cgcagcccat gctctgctcg acgagctcac cgtctggggc       900
     acacccgaca ccgctcacga ccacctccag cgctggtaca ccgcaggcgc cgagacaccg       960
     atcctcaccc tcaccctccc accccaccgc accaccgccg aactcgacta catgctcgaa      1020
     accatgcgcc cacacccctg a                                                1041
//

If you have problems or comments...

PBIL Back to PBIL home page