(data stored in ACNUC7421 zone)

EMBL: AP011115.PE171

AP011115.PE171       Location/Qualifiers
FT   CDS_pept        149909..150151
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_01710"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_01710"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48418"
FT                   /db_xref="UniProtKB/TrEMBL:C1ASG9"
FT                   /protein_id="BAH48418.1"
FT                   /translation="MVDGRHARHGGGKRKSNAEEIVADGRSILAIIWHPLDGAGATFHG
FT                   LGTEHSSRNVKPGHEDTQSHRQLETLRHVTLIPAA"
     gtggtcgacg gccggcacgc cagacacggt ggcgggaaac ggaaaagcaa cgcagaggaa        60
     atcgttgccg acggtcggtc catcctggcc atcatctggc accccctcga cggcgcgggc       120
     gccactttcc acggcctcgg gaccgagcac tccagccgca acgtcaaacc cggacatgaa       180
     gatacgcaat cacatcggca actcgaaacc ctccgccacg tcaccctcat cccggccgcc       240
     tga                                                                     243
//

If you have problems or comments...

PBIL Back to PBIL home page