(data stored in ACNUC7421 zone)

EMBL: AP011115.PE172

AP011115.PE172       Location/Qualifiers
FT   CDS_pept        complement(150240..151577)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_01720"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_01720"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48419"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:C1ASH0"
FT                   /protein_id="BAH48419.1"
FT                   /translation="MTTRIGHRAVVLGASIAGLLAARVLSEAYAQVIVVDHDHLPGTAA
FT                   PRRCVPQARHTHVLIERGQQVLEELFPGFTDDLAARGVPTLDNLRDVRWCLSGHRFPQP
FT                   ESGMTVVSASRSYLEGCVRARVSELPGVTLVDCCDAAGLTMTPDRRRVTGVRVLRRADG
FT                   SAEEVLDADLVVDATGRGSRAPTWLAELGFESPEEEKLQVGLGYTTQIYRAPAPGLGND
FT                   LGVVIGPTPDAPRGGALQLLEGNRFLVTLMGMLGDYPPTDPDGFLDFARTLPIPDLCDV
FT                   IRDAEPLERARSFRFPASVRRRYERLSRFPAGFLVTGDALCSFNPIYAQGMTVAALEAI
FT                   TLRRHLQRATEPHPRTFFRDVAKMIDVPWDMSVGADLAFPDVIGARSPKMRIANAYIPR
FT                   LHAAAAHDPVLATTFIRVAALVDRPERLMSPGTVLRVLRQILPRPR"
     atgacaactc gaatcggtca ccgagcagtg gtgctcggcg ccagcatcgc cggcttactc        60
     gcggcccggg tgctgtccga ggcgtatgcg caggtgatcg tggtggatca cgatcacctc       120
     ccgggtaccg cggccccacg ccgctgtgtg ccccaagccc ggcacaccca cgtgctgatc       180
     gaacgcggtc agcaggtcct cgaggagctg ttcccgggct tcaccgacga cctggctgcg       240
     cgtggggtgc cgacattgga caacctgcgc gacgtgcgat ggtgcctgag cgggcaccgg       300
     tttccgcagc cggagagcgg gatgaccgtc gtcagcgcca gccgatcgta cctggagggc       360
     tgcgtgcgtg cccgggtgag cgaactcccc ggtgtcacac tcgtggattg ctgcgacgcc       420
     gccggcctga ccatgacgcc cgaccgtcgc cgcgtcaccg gggtccgtgt gcttcgacgg       480
     gccgacggca gcgccgagga ggtcctcgac gccgacctgg tcgtcgacgc gaccgggcgg       540
     ggttcacgag ccccaacatg gttggcggag ctgggttttg aatcgccaga ggaggagaag       600
     ctgcaggtgg gtctcggcta cacgacccag atctaccgag ccccggcccc gggtttgggc       660
     aatgacctcg gggtcgtgat cggtccgacg cccgatgctc cgcggggcgg cgccttgcag       720
     ctgcttgagg ggaaccgctt tctggtgacg ctgatgggaa tgctcggcga ctatccgccc       780
     accgatccgg acggctttct cgacttcgcc cgtaccctac cgatcccgga tctctgcgac       840
     gtgatccggg acgccgagcc gctcgagcgg gcccggtcgt tccggtttcc ggcgagcgtc       900
     cgccggcggt atgaacgcct gtcacgattc cccgccggat tcctcgtgac cggagacgcc       960
     ctgtgcagct tcaacccgat ttacgcgcag ggcatgactg tcgcggctct cgaggcgatt      1020
     acgctgcgac gtcacctgca acgagccacc gaaccccacc cacgtacgtt ctttcgcgac      1080
     gtcgcgaaaa tgatcgacgt gccgtgggac atgtcggtcg gcgcggacct ggccttcccc      1140
     gacgtgatcg gagcccgcag cccgaagatg cggatcgcca acgcctatat tccgcgtctg      1200
     catgcggctg ccgcccatga tcccgtgctc gccacgacct tcatccgcgt cgccgccctg      1260
     gtcgatcgcc cggagcggct gatgagcccc ggcaccgtgc tgcgcgtcct gcgccagatc      1320
     ctgccccgcc cccgctag                                                    1338
//

If you have problems or comments...

PBIL Back to PBIL home page